Part Number Hot Search : 
G7262S LB1889 3323W504 UM120 30150 3012MU2 2A100 AP3409DN
Product Description
Full Text Search
 

To Download L9D3256M72SBG2 Datasheet File

  If you can't view the Datasheet, Please click here to try to view without PDF Reader .  
 
 


  Datasheet File OCR Text:
  integrated module products logic devices incorporated www.logicdevices.com 1 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product ddr3 integrated module [imod]:  x9 dd 9 dd 4 9?9ru/2: 32:(59 dd 9 dd 4 9?9  x9ru9fhqwhuwhuplqdwhg push/pull output  x3dfndjhpp[pp[pp [pdwul[zedoov  x0dwul[edooslwfkpp 6sdfhvdylqjirrwsulqw 7khupdoo\hqkdqfhg,pshgdqfh pdwfkhglqwhjudwhgsdfndjlqj  'liihuhqwldoelgluhfwlrqdogdwdvwureh qelwsuhihwfkdufklwhfwxuh  lqwhuqdoedqnv shuzrugzrugv lqwhjudwhglqsdfndjh   1rplqdodqgg\qdplfrqglhwhuplqd - wlrq 2'7 irugdwdvwurehdqgpdvn signals.  3urjudppdeoh&$6 5($' odwhqf\ &/ dqg  &$6 :5,7( odwhqf\ &:/  features 9, and 11  )l[hgexuvwohqjwk %/ ridqgexuvw fkrs %& ri  6hohfwdeoh%&ru%/rqwkhio\ 27)  6hoi$xwr5hiuhvkprghv  2shudwlqj7hpshudwxuh5dqjh dpelhqwwhps 7 $  x&rpphufldo?&wr?&  x,qgxvwuldo?&wr?&vxssruwlqj 6(/) $8725()5(6+  x([whqghg?&wr?&pdqxdo 5()5(6+rqo\  x0lo7hps?&wr?&pdqxdo 5()5(6+rqo\  &25(forfnlqjiuhtxhqflhv 0+]  'dwd7udqvihu5dwhv 0esv :ulwhohyholqj multipurpose register 2xwsxw'ulyhu&doleudwlrq  vsdfhvdylqjvzklohsurylg - lqjdvxuidfhprxqwiulhqgo\slwfk pp  5hgxfhg,2urxwlqj   5hgxfhgwudfhohqjwkvgxhwr wkhkljko\lqwhjudwhglpshgdqfh pdwfkhgsdfndjlqj  +ljk7&(rujdqlfodplqdwhlqwhu - srvhuirulpsuryhgjodvvvwdelolw\ ryhudzlghrshudwlqjwhpshudwxuh  6xlwdelolw\rixvhlq+ljk5holdelolw\ dssolfdwlrqvuhtxlulqj0lowhpsqrq khuphwlfghylfhrshudwlrq benefits 1rwh7klvlqwhjudwhgsurgxfwdqgrulwvvshflilfdwlrqv duhvxemhfwwrfkdqjhzlwkrxwqrwlfh/dwhvwgrfxphqw vkrxogehuhwulhyhgiurp/',sulruwr\rxughvljq frqvlghudwlrq o rder n umber s peed g rade p kg f ootprint i/o p itch p kg n o . pp[pp  imod part information bg2 pp ddr3-1866 ddr3-1600 ddr3-1333 ddr3-1866 ddr3-1600 ddr3-1333 /'06%*[ /'06%*[ /'06%*[ /'06%*[ l9d3256m80sbg2x125 l9d3256m80sbg2x15 preliminar p p k k g g f f oo oo t na na na na in in min min ry information qxdo xdo hv v    v        j ose register e register w 'ulyhu ul &doleud doleud   qjwkv qjwkv gxh gx wr judwhg dw lpshgd lpshgd dfndjlqj fndjlqj ( ( rujdqlf rujdqlf odp odp iru iru lpsuryhg lpsuryhg hu hu d d z lgh rshu rsh 6xlwdelolw\ 6xlwdelolw\ ri ri dssolfdwlrq dssolfdw khuphw khuphw ry eliminar ar mi mi lim lim lim lim 16 dr3-1333 r3-186 ddr3-1 dr
sample part number: l9d3256mxxsbg2 word = 256mb speed grade 1.5ns / 667mhz 1.25ns / 800mhz 1.07ns / 933mhz 15 125 107 256m l9d3 temperature industrial (-40 o c to 85 o c) extended (-40 o c to 105 o c) military (-55 o c to 125 o c) i e m note: not all options can be combined. please see our part catalog for available offerings. xxs bg2 ddr3 imod wordwidth x72 x80 s = single channel 16 x 22mm pbga code code x xxx commercial (0 o c to 70 o c) c x voltage 1.35v 1.5v l - code logic devices incorporated www.logicdevices.com 2 july 24, 2013 lds-l9d3256mxxsbg2 rev b 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 high performance, integrated memory module product features f igure 1 - ddr3 p art n umbers &rqiljxudwlrq 5hiuhvk&rxqw 52:$gguhvvlqj %dqn$gguhvvlqj &roxpq$gguhvvlqj >0hj[edqnv[@[ 8k . $>@  $>@  %$>@ . $>@ parameter 256 meg x 72/80 t able 1: a ddressing
bank active reading writing activating refreshing self refresh idle active power- down zq calibration from any state power applied reset procedure power on initialization mrs, mpr, write leveling preharge power- down writing automatic sequence command sequence preharging read read read read ap read ap read ap pre, prea pre, prea pre, prea write write cke l cke l cke l write write ap write ap write ap pde pde pdx pdx srx sre ref mrs act reset zqcl zqcl/zqcs reading act = activate prea=precharge all srx = self refresh exit mpr = multipurpose register read = rd, rds4, rds8 write = wr, wrs4, wrs8 mrs = mode register set read ap = rdap, rdaps4, rdaps8 write ap = wrap, wraps4, wraps8 pde = power-down entry ref = refresh zqcl = zq long calibration pdx = power-down exit reset = start reset procedure zqcs = zq short calibration pre = precharge sre = self refresh entry logic devices incorporated www.logicdevices.com 3 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product state diagram f igure 2 - s implified s tate d iagram
logic devices incorporated www.logicdevices.com 4 july 24, 2013 lds-l9d3256mxxsbg2 rev b 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 high performance, integrated memory module product 7kh ''5 6'5$0 xvhv grxeoh gdwd udwh dufklwhfwxuh wr dfklhyh kl jk vshhgrshudwlrq7khgrxeohgdwdudwh ''5 dufklwhfwxuhlvdqqsuhihwfk zlwkdqlqwhuidfhghvljqhgwrwudqvihuwzrgdwdzrugvshuforfnf\fohdwwkh ,2slqv$vlqjoh5($'ru:5,7(dffhvviruwkh''56'5$0frq vlvwv ridvlqjohqelwzlghrqhforfnf\fohgdwdwudqvihudwwkhlqwhuqdophpru\ fruhdqghljkwfruuhvsrqglqjqelwzlghrqhkdoiforfnf\fohgdwdwudqvihu at the i/o pin. 7kh gliihuhqwldo vwurehv '46[ '46[?  duh wudqvplwwhg h[whuqdo o\ dorqj zlwkgdwdiruxvhlqgdwdfdswxuhdwwkh''56'5$0lqsxwuhfh lyhu'46 lvfhqwhudoljqhgzlwkgdwdiru:5,7(v7kh5($'gdwdlvwudqv plwwhge\ wkh''56'5$0dqghgjhdoljqhgwrwkhgdwdvwurehv 7kh ''5 6'5$0 rshudwhv iurp d gliihuhqwldo forfn &.[ &.[?  7kh furvvlqjri&.jrlqj+,*+dqg&.?jrlqj/2:lvuhihuuhgwrdvwkhsrvl - wlyhhgjhri&orfn &. &rqwuro&rppdqgdqg$gguhvvvljqdov duhuhj- lvwhuhgdwhyhu\srvlwlyhhgjhri&.,qsxwgdwdlvuhjlvwhuhg rqwkhiluvw ulvlqj hgjh ri '46 diwhu wkh :5,7( suhdpeoh dqg rxwsxw gdwd lv  uhihu - hqfhgrqwkhiluvwulvlqjhgjhri'46diwhuwkh5($'suhdpeoh 5($' dqg :5,7( dffhvvhv wr wkh ''5 6'5$0 duh exuvwrulhqwhg  $ffhvvhv vwduw dw d vhohfwhg orfdwlrq dqg frqwlqxh iru d surjudpphg qxpehuriorfdwlrqvlqdsurjudpphgvhtxhqfh$ffhvvhvehjlqzlwkwkh uhjlvwudwlrqridq$&7,9$7(frppdqgzklfklvwkhqiroorzhge\ d5($' ru:5,7(frppdqg7khdgguhvvelwvuhjlvwhuhgfrlqflghqwzlwk wkh$&7, - 9$7(frppdqgduhxvhgwrvhohfwwkhedqndqgwkhvwduwlqjfroxp qorfd - wlrqiruwkhexuvwdffhvv ''56'5$0ghylfhvxvh5($'dqg:5,7(%/dqg%&$q$872 35(&+$5*(ixqfwlrqpd\ehhqdeohgwrsurylghdvhoiwlphg52:3 5(- &+$5*(wkdwlvlqlwldwhgdwwkhhqgriwkhexuvwdffhvv $vzlwkvwdqgdug''56'5$0ghylfhvwkhslsholqhgpxowledqndufklwhf - wxuhriwkh''56'5$0doorzvirufrqfxuuhqwrshudwlrqwkhuhe\surylg - lqjkljkedqgzlgwke\klglqj52:35(&+$5*(dqg$&7,9$7,21wlph $ 6(/) 5()5(6+ prgh lv surylghg iru doo whpshudwxuh judgh riihulqjv dorqjzlwk$8726(/)5()5(6+iru,qgxvwuldosurgxfwdvzhoodvsrzhu vdylqj32:(5'2:1prgh functional description i ndustrial t emperature 7kh lqgxvwuldo whpshudwxuh ,  ghylfh uhtxluhv wkh dpelhqw whpshudwxuh qrwh[fhhg ? &ru ? &-('(&vshflilfdwlrqvuhtxluhwkh5()5(6+ udwhwrgrxeohzkhq7 $ h[fhhgv ? &wklvdovruhtxluhvxvhriwkhkljk whpshudwxuh6(/)5()5(6+rswlrq$gglwlrqdoo\2'7uhvlvwdqfh dqg wkh ,1387287387 lpshgdqfh pxvw eh ghudwhg zkhq wkh 7 $ is <0 ? & ru! ? & e xtended t emperature 7kh([whqghgwhpshudwxuh ( ghylfhuhtxluhvwkhdpelhqwwhpshudwxuh qrwh[fhhg ? &ru ? &-('(&vshflilfdwlrqvuhtxluhwkhuhiuhvk udwhwrgrxeohzkhq7 $ h[fhhgv ? &wklvdovruhtxluhvxvhriwkhkljk whpshudwxuh6(/)5()5(6+rswlrq$gglwlrqdoo\2'7uhvlvwdqfh dqg wkh ,1387287387 lpshgdqfh pxvw eh ghudwhg zkhq wkh 7 $ is <0 ? & or >85 ? & m ilitary , e xtreme o perating t emperature 7kh0lo7hps 0 ghylfhuhtxluhvwkhdpelhqwwhpshudwxuhqrwh[fhhg -55 ? &ru ? &-('(&uhtxluhvwkh5()5(6+udwhgrxeohzkhq7 $ h[fhhgv ? &dqg/',uhfrpphqgvdqdgglwlrqdoghudwlqjdvvshflilhg lq wklv grfxphqw dv wr surshuo\ pdlqwdlq wkh '5$0 fruh fhoo fkdujh dw whpshudwxuhvderyh7 $ >105 ? &
d4 ba clk\ clk cke cas\ ras\ we\ odt reset\ cs\ a 14-a0 a dq 15    dq 8 dq 7    dq 0 d3 dq 15    dq 8 dq 7    dq 0 d2 dq 15    dq 8 dq 7    dq 0 d1 dq 15    dq 8 dq 7    dq 0 cs\ reset\ odt we\ ras\ cas\ cke clk clk\ d0 dq 15    dq 8 dq 7    dq 0 dq 15    dq 8 dq 7    dq 0 dm 1 dm 0 dqs1, dqs1\ dqs0, dqs0\ dq 31    dq 24 dq 23    dq 16 dqs3, dqs3\ dqs2, dqs2\ dq 47 dq 40 dq 39 dq 32 dqs5, dqs5\ dqs4, dqs4\ dq 63 dq 56 dq 55 dq 48 dqs7, dqs7\ dqs6, dqs6\ dq 79 dq 72 dq 71 dq 64 dqs9, dqs9\ dqs8, dqs8\ dm 3 dm 2 dm 5 dm 4 dm 7 dm 6 dm 9 dm 8 b a2-0 a ba clk\ clk cke cas\ ras\ we\ odt reset\ cs\ ba clk\ clk cke cas\ ras\ we\ odt reset\ cs\ a ba clk\ clk cke cas\ ras\ we\ odt reset\ cs\ a ba clk\ clk cke cas\ ras\ we\ odt reset\ cs\ a zq vssq 240 1% vssq zq vssq zq vssq zq vssq zq logic devices incorporated www.logicdevices.com 5 july 24, 2013 lds-l9d3256mxxsbg2 rev b 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 high performance, integrated memory module product f igure 3 - f unctional b lock d iagram
v dd vssq vss v dd q vssq v dd v dd q vssq vss v dd v dd q vssq v dd q dm8 dq68 dq71 dqs8# dq65 dq66 dq72 dqs9 dq75 dq78 dq77 dm9 dq70 dq69 dqs8 dq67 dq64 dq74 dqs9# dq73 dq76 dq79 vss v dd q v dd vssq v dd q vss vssq v dd q v dd vssq v dd q vss vssq dm6 dq52 dq55 dqs6# dq49 dq50 dq56 dqs7 dq59 dq62 dq61 vss dm7 dq54 dq53 dqs6 dq51 dq48 dq58 dqs7# dq57 dq60 dq63 v dd vssq vss v dd q vssq v dd v dd q vssq vss v dd v dd q vssq v dd q a14 a11 v dd a1 ba2 vss v dd vss v dd vss vss a13 a7 a4 a3 ba0 cs# odt clk# cas# v dd vrefdq v ss a8 a6 a5 a12 ba1 we# cke clk ras# v ss reset# a9 a2 vss a0 a10 v dd vss v dd vss v dd v dd vrefca vss v dd q v dd vssq v dd q vss vssq v dd q v dd vssq v dd q vss vssq v dd dm4 dq36 dq39 dqs4# dq33 dq34 dq40 dqs5 dq43 dq46 dq45 dm5 dq38 dq37 dqs4 dq35 dq32 dq42 dqs5# dq41 dq44 dq47 v dd vssq vss v dd q vssq v dd v dd q vssq vss v dd v dd q vssq v dd q dm2 dq20 dq23 dqs2# dq17 dq18 dq24 dqs3 dq27 dq30 dq29 dm3 dq22 dq21 dqs2 dq19 dq16 dq26 dqs3# dq25 dq28 dq31 vss v dd q v dd vssq v dd q vss vssq v dd q v dd vssq v dd q vss vssq dm0 dq4 dq7 dqs0# dq1 dq2 dq8 dqs1 dq11 dq14 dq13 dm1 dq6 dq5 dqs0 dq3 dq0 dq10 dqs1# dq9 v dd vssq vss v dd q vssq v dd v dd q vssq vss 12345678910111213 a a b b c c d d e e f f g g h h j j k k l l m m n n p p r r t t 12345678910111213 address unpopulated level ref v + (i/o power) cntrl gnd (core) data io v dd u v w y aa u v w y aa v dd q gnd (i/o) v + (core power) 271bga-1.00mm pitch - x72/80, scb vssq v dd q dq12 dq15 v dd logic devices incorporated www.logicdevices.com 6 july 24, 2013 lds-l9d3256mxxsbg2 rev b 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 high performance, integrated memory module product f igure 4 - sdram - ddr3 p inout t op v iew ball /signal location (pbga)
logic devices incorporated www.logicdevices.com  july 24, 2013 lds-l9d3256mxxsbg2 rev b 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 high performance, integrated memory module product t able 2 - b all /s ignal l ocation and d escription ball assignments symbol type description l10, p10, l12, n10, n11, m22, m12, n12, m13, l13, l9, p12, m10, n13, p13 n9, m9, p9 m6, n6 0 n8 &%)(- +87< : m5 n5 m8 a 0, a 1, a 2, a 3, a 4, a 5, a 6, a 7, a 8, a 9, a 10 /ap, a 11, a 12 / bc, a 13, a 14 ba 0 , ba 1, ba 2 clk x , clk x \ cke cs\ dmx ras\ cas\ we\ input input input input input input input input input address inputs: 3urylghwkh52:dgguhvviru$&7,9$7(frppdqgvdqgwkhfroxpqdgguhvv dqgdxwrsuhfkdujhelw $ 10 iru5($'<:5,7(frppdqgvwrvhohfwrqhorfdwlrqrxwriwkh phpru\duud\lqwkhuhvshfwlyhedqn$ 10 vdpsohggxulqjd35(&+$5*(frppdqgghwhuplqhv zkhwkhuwkh35(&+$5*(dssolhvwrrqhedqn $ 10 /2: edqnvhohfwhge\%$>@rudooedqnv $ 10 +,*+ 7khdgguhvvlqsxwvdovrsurylghwkhrsfrghgxulqjd/2$'02'(frppdqg $gguhvvlqsxwvduhuhihuhqfhgwr9uhi&$$ 12 %&zkhqhqdeohglqwkhprghuhjlvwhu 05 $ 12 lvvdpsohggxulqj5($'dqg:5,7(frppdqgvwrghwhuplqhzkhwkhu exuvwfkrs/2: %& 4 exuvwfkrs  bank address inputs: %$>@ghilqhwkhedqnwrzklfkdq$&7,9$7(5($':5,7(ru 35(&+$5*(frppdqglvehlqjdssolhg%$>@ghilqhzklfkprgh uhjlvwhu 05 0 , mr 1 , mr 2 , or mr 3 lvordghggxulqjwkh/2$'02'(frppdqg%$>@duhuhihuhqfhgwr9uhi&$ clock: &.[dqg&.[?duhgliihuhqwldoforfnlqsxwvrqhgliihuhqwldosdlushu:25'irxu:25'v frqwdlqhglqwkh/'[[*surgxfw$oofrqwurodqgdgguhvvlqsxwvljqdovduhvdpsohgrqwkh furvvlqjriwkhsrvlwlyhhgjhri&.[dqgwkhqhjdwlyhhgjhri&.[?2xwsxwgdwdvwurehv 8'46[ 8'46[?dqg/'46[/'46[? lvuhihuhqfhgwrwkhfurvvlqjri&.[dqg&.[? clock enable: &.(hqdeohvdqgglvdeohvlqwhuqdoflufxlwu\dqgforfnvrqwkh6 '5$07kh vshflilfflufxlwu\wkdwlvhqdeohgglvdeohglvghshqghqwxsrqwkh''56'5$0frqiljxudwlrqdqg rshudwlqjprgh7dnlqj&.(/2:surylghv35(&+$5*(srzhugrzqd qg6(/)5()5(6+ rshudwlrqv dooedqnvlgoh rudfwlyhsrzhugrzq urzdfwlyhl qdq\edqn &.(lvv\qfkurqrxv irusrzhugrzqhqwu\dqgh[lwdqgiruvhoiuhiuhvkhqwu\&.(lvdv\qfkurqrxviruvhoiuhiuhvk h[lw,qsxwexiihuv h[foxglqj&.[&.[?&.(5(6(7dqg2'7 duhglvdeohggxulqj6(/) 5()5(6+&.(lvuhihuhqfhgwr9uhi&$ chip select: &6?hqdeohv uhjlvwhuhg/2: dqgglvdeohvwkhfrppdqgghfrghu$oofrppdqgv duhpdvnhgzkhq&6?lvuhjlvwhuhg+,*+&6?surylghviruh[whuqdoudqnvhohfwlrqrqv\vwhpvzlwk pxowlsoh udqnv&6?lvfrqvlghuhgsduwriwkhfrppdqgfrgh&6?lvuhihuhqfhgwr9uhi&$ input data mask: '0[lvwkhe\hzlghgdwdpdvniruwkhuhvshfwlyhelwgdwdilhogv7khgdwd pdvnlqsxwpdvnv:5,7(gdwd%\whgdwdvpdvnhgzkhq'0[lvvdpsohg+,*+7kh'0[slqv duhlqsxwvrqo\wkhslqvhohfwulfdoordglqjlvghvljqhgwrpdw fkwkdwriwkh'4'46[dqg'46[? pins. row address strobe/select: 'hilqhvwkhfrppdqgehlqjhqwhuhgdorqj&$6?:(?dqg&6? 7klvlqsxwslqlvuhihuhqfhgwr9uhi&$ column address strobe/select: 'hilqhvwkhfrppdqgehlqjhqwhuhgdorqjzlwk5$6?:(? dqg&6?7klvlqsxwslqlvuhihuhqfhgwr9uhi&$ write enable input: 'hilqhvwkhfrppdqgehlqjhqwhuhgdorqjzlwk&$6?5$6?dqg&6?7klv lqsxwslqlvuhihuhqfhgwr9uhi&$
logic devices incorporated www.logicdevices.com 8 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 2 - b all /s ignal l ocation and d escription c ontinued ball assignments symbol type description 1 m3 %&&%() )(+--+ 7887:< <: %&&&& %%& &%%&%& &% ())() (() )(()() f2, f3 +--+-+ +- -++-+- -+ odt reset\ dqsx, dqsx\ dq 0, dq 1, dq 2, dq 3, dq 4, dq 5, dq 6, dq 7 dq 8, dq 9, dq 10, dq 11, dq 12, dq 13, dq 14, dq 15 dq 16, dq 17, dq 18, dq 19, dq 20, dq 21, dq 22, dq 23 dq 24, dq 25, dq 26, dq 27, dq 28, dq 29, dq 30, dq 31 dq 32, dq 33, dq 34, dq 35, dq 36, dq 37, dq 38, dq 39 dq 40, dq 41, dq 42, dq 43, dq 44, dq 45, dq 46, dq 47 input input input i/o i/o i/o i/o i/o i/o on-die termination: 2'7hqdeohv zkhquhjlvwhuhg+,*+ dqgglvdeohvwhuplqdwlrquhvlvwdqfh lqwhuqdowrwkh''56'5$0:khqhqdeohglqqrupdorshudwlrq 2'7lvrqo\dssolhgwrhdfkri wkhiroorzlqjvljqdov'4>@/'4;[?8'46[?8'0[dqg/'0[7kh2'7lqsxwlvljqruhgli glvdeohgyldwkh/2$'02'(uhjlvwhufrppdqg2'7lvuhihuhqfhgwr9uhi&$ reset: $qlqsxwfrqwuroslqdfwlyh/2:uhihuhqfhgwr9vv7kh5(6(7?lqsxwuhfhlyhulvd &026lqsxwghilqhgdvdudlowrudlovljqdozlwk'&+,*+ t[9 dd dqg'&/2:d[9 dd q. 5(6(7?dvvhuwlrqdqgghdvvhuwlrqduhdv\qfkurqrxv data strobe, byte (per word): 2xwsxwhgjhdoljqhgzlwk5($'gdwd,qsxwfhqwhudoljqhgzlwk :5,7(gdwd data input/output: /rzhu%\wh:25'3lquhihuhqfhgwr9uhi'4 data input/output: 8sshu%\wh:25'3lquhihuhqfhgwr9uhi'4 data input/output: /rzhu%\wh:25'3lquhihuhqfhgwr9uhi'4 data input/output: 8sshu%\wh:25'3lquhihuhqfhgwr9uhi'4 data input/output: /rzhu%\wh:25'3lquhihuhqfhgwr9uhi'4 data input/output: 8sshu%\wh:25'3lquhihuhqfhgwr9uhi'4
logic devices incorporated www.logicdevices.com 9 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 78878 778 877878 87 :<<:< ::< <::<:< <: $$$'' g2, g8, g13, j13, k5, k11, l2, l4, l6, l8, m2, 133355 599$$$$ $$ $$$$'' ''*** g10, k3, k6, k9, k12, 555599 99$$$$$$ $$ $$''' g5, g11, k2, k8, k13, ///013 p4, p6, p8, r5, r11, 7999$$ $$ $$$$'' ''*** *.... 555599 99$$$$$$ $$ t able 2 - b all /s ignal l ocation and d escription c ontinued ball assignments symbol type description dq 48, dq 49, dq 50, dq 51, dq 52, dq 53, dq 54, q 55 dq 56, dq 57, dq 58, dq 59, dq 60, dq 61, dq 62, dq 63 dq 64, dq 65, dq 66, dq 67, dq 68, dq 69, dq 70, dq 71 dq 72, dq 73, dq 74, dq 75, dq 76, dq 77, dq 78, dq 79 v dd v dd q v ss v ss q i/o i/o i/o i/o supply supply supply supply data input/output: /rzhu%\wh:25'3lquhihuhqfhgwr9uhi'4 data input/output: 8sshu%\wh:25'3lquhihuhqfhgwr9uhi'4 data input/output: /rzhu%\wh:25'3lquhihuhqfhgwr9uhi'4 data input/output: 8sshu%\wh:25'3lquhihuhqfhgwr9uhi'4 3rzhu6xsso\9?9 'dwd,26xsso\9?9 ground 'dwd,2*urxqg,vrodwhgiurp&ruhirulpsuryhgqrlvhlppxqlw\
logic devices incorporated www.logicdevices.com 10 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product l3 n3 %%&&( ())++ j1, l1, m1, n1, p1, p3, 88:: << t able 2 - b all /s ignal l ocation and d escription c ontinued ball assignments symbol type description v refca v refdq unpopulated supply supply 9rowdjh5hihuhqfh&25(9uhi&$pxvwehpdlqwdlqhgdwdoowlphv 9rowdjh5hihuhqfh,29uhi'4pxvwehpdlqwdlqhgdwdoowlphv 8qsrsxodwhgxqsodwhgpdwul[orfdwlrq v
1.00 nom 1.00 nom 12.00 nom ? 1rwh$ooglphqvlrqvlqpp 0$; 20.00 nom ? [120  $ b & d ( f g + j k l m n p r t 8 9 : < $$ ? ? logic devices incorporated www.logicdevices.com 11 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 5 - m echanical d rawing
p ackage o utline d imensions logic devices incorporated www.logicdevices.com 12 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 127(6 9 dd dqg9 dd 4pxvwehzlwklqp9rihdfkrwkhudwdoowlphvdqg9 5() pxvwqrwehjuhdwhuwkdq[9 dd 4:khq9 dd and 9 dd 4duhohvvwkdq099 5() pd\ehdp9 0d[rshudwlqjdpelhqwwhpshudwxuh t $ lvphdvxuhglqwkhfhqwhuriwkhsdfndjh 'hylfh)xqfwlrqdolw\lvqrwjxdudqwhhgliwkh'5$0ghylfhh[fhhgvwkh0d[lpxp7 $ during operation. 127(6 9 dd  9?p99 dd q  9 dd 9 5()  9 ss i 0+]t $ = 25&9 287  '&  [9 dd q 9 287 shdnwrshdn  9 '0lqsxwlvjurxshgzlwk,2slqvuhiohfwlqjwkhvljqdolvjurxshgzlwk'4dqgwkhuhiruhpdwfkhglqordglqj & &&46 lviru'46yv'46? & dio  &,2 '4 [ &,2>'46@&,2>'46?@ ([foxghv&.&.? & ',b&17/  &, &17/ [ &&.>&.@&&.>&.?@ &17/ 2'7&6?dqg&.( & ',b&0'b$''5  &, &0'b$''5 [ &&.>&.@&&.>&.?@ &0' 5$6?&$6?dqg:(?$''5 >q@ capacitance parameter symbol min max min max min max units notes &.dqg&.? single-end i/o: dq, dm 'liihuhqwldo,2'46'46? inputs 5$6?&$6?:(?&6?&.(5(6(7?$''5%$ t able 4: i nput /o utput c apacitance & &. & 10 & 10 & i_shared 3.0 1.5 1.5 4.0 6.1 2.5 2.5  pf pf pf pf 2 3 5 symbol parameter min max units notes 9 dd 9 dd q 9 in 9 287 t $ industrial t $ ([whqghg t $ 0lowhps t stg 9 9 9 & & & & 1 1 1 2,3 2,3 2,3 2,3 t able 3: a bsolute m aximum r atings    85 105 125 120 -0.4 -0.4 -0.4 -40 -40 -55 -55 9 dd 6xsso\9rowdjhuhodwlyhwr9 ss 9 dd 6xsso\9rowdjhuhodwlyhwr9 ss q 9rowdjhrqdq\slquhodwlyhwr9 ss 2shudwlqj$pelhqw7hpshudwxuh 2shudwlqj$pelhqw7hpshudwxuh 2shudwlqj$pelhqw&dvh7hpshudwxuh 6wrudjh7hpshudwxuh 3.0 1.5 1.5 4.0 6.1 2.5 2.5  ddr3-1333 ddr3-1600 ddr3-1866 3.0 1.5 1.5 4.0 6.1 2.5 2.5 
logic devices incorporated www.logicdevices.com 13 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t &. 0,1 , dd &/, dd t 5&' 0,1 , dd w5& 0,1 , dd t 5$6 0,1 , dd t 53 0,1 , dd t )$: t rrd i dd t 5)& i dd parameter 10-10-10 11-11-11 13-13-13 t able 5: t iming p arameters for i dd m easurements - c lock u nits ns &. &. &. &. &. &. &. &. 1.5 10 10 34 24 10 30 5  ddr3-1333 -15 x64 x64 0[ ; ddr3-1600 -12 ddr3-1866 -11 1.25 11 11 36 28 12 33 6 90  13 13 40 32 14 36 6 110
ck, ck\ cke sub-loop cs\ ras\ cas\ we\ odt ba [2:0] a [15:11] a [10] a [9:7] a [6:3] a [2:0] 00110000000 10000000000 10000000000 11110000000 11110000000 00100000000 001100000f0 100000000f0 100000000f0 111100000f0 111100000f0 001000000f0 1 2 3 4 5 6 7 repeat sub-loop 0, use ba [2:0] = 6 repeat sub-loop 0, use ba [2:0] = 7 - - - - - - - - repeat cycles n rc +1 through n rc +4 until 2 x rc - 1, truncate if needed repeat sub-loop 0, use ba [2:0] = 1 repeat sub-loop 0, use ba [2:0] = 2 repeat sub-loop 0, use ba [2:0] = 3 repeat sub-loop 0, use ba [2:0] = 4 repeat sub-loop 0, use ba [2:0] = 5 d\ d\ pre repeat cycles 1 through 4 until n ras - 1, truncate if needed repeat cycles 1 through 4 until n rc - 1, truncate if needed repeat cycles n rc +1 through n rc +4 until n rc - 1 + n ras - 1, truncate if needed - - - - d\ d\ pre act d d 4 x n rc 6 x n rc 8 x n rc 10 x n rc 12 x n rc 14 x n rc n rc + 3 n rc + 4 - n rc + n ras - 2 x nrc - n ras - n rc n rc + 1 n rc + 2 cycle number command 0 data 1 2 act d d 3 4 0 static high toggling logic devices incorporated www.logicdevices.com 14 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 6: i dd 0 m easurement l oop
ck, ck\ cke sub-loop cs\ ras\ cas\ we\ odt ba [2:0] a [15:11] a [10] a [9:7] a [6:3] a [2:0] 00110000000 10000000000 10000000000 11110000000 11110000000 01010000000 00100000000 001100000f0 100000000f0 100000000f0 111100000f0 111100000f0 010100000f0 001000000f0 1 2 3 4 5 6 7 cycle number command data 0 1 2 act d d - 3 4 - nrcd - nras - nrc n rc +1 nrc +2 n rc +3 n rc +4 - n rc + nrcd - n rc + nras 2 x n rc 2 x n rc 2 x n rc 2 x n rc 2 x n rc 2 x n rc 2 x n rc d\ d\ rd pre act d d d\ d\ rd pre repeat sub-loop 0, use ba [2:0] = 1 - 00110011 - repeat sub-loop 0, use ba [2:0] = 2 repeat sub-loop 0, use ba [2:0] = 3 repeat sub-loop 0, use ba [2:0] = 4 repeat sub-loop 0, use ba [2:0] = 5 repeat sub-loop 0, use ba [2:0] = 6 repeat sub-loop 0, use ba [2:0] = 7 repeat cycles 1 through 4 until nrcd - 1, truncate if needed repeat cycles 1 through 4 until nras - 1, truncate if needed repeat cycles 1 through 4 until nrc - 1, truncate if needed repeat cycles nrc + 1 through nrc + 4 until nrc + nrcd - 1, truncate if needed repeat cycles nrc + 1 through nrc + 4 until nrc + nras - 1, truncate if needed - - - - - - - - 00000000 - toggling static high 0 repeat cycle nrc + 1 through nrc + 4 until 2 x nrc - 1, truncate if needed logic devices incorporated www.logicdevices.com 15 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 7: i dd 1 m easurement l oop
logic devices incorporated www.logicdevices.com 16 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 8: i dd m easurement c onditions f or p ower -d own c urrents name 7lplqj3dwwhuq &.( ([whuqdo&orfn t &. t 5& t 5$6 t 5&' t rrd t 5& &/ $/ &6? &rppdqg,qsxwv 52:&2/801$ggu %dqn$gguhvv dm data i/o 2xwsxw%xiihu'4'46 odt burst length $&7,9(%dqn v ,'/(%dqn v 6shfldo1rwhv n/a /2: toggling t &. 0,1 , dd q?d q?d q?d q?d q?d q?d q?d +,*+ /2: /2: /2: /2: mid-level (qdeohg (qdeohg2)) 8 none $oo q?d n/a /2: toggling t &. 0,1 , dd q?d q?d q?d q?d q?d q?d q?d +,*+ /2: /2: /2: /2: mid-level (qdeohg (qdeohg2)) 8 none $oo q?d n/a +,*+ toggling t &. 0,1 , dd q?d q?d q?d q?d q?d q?d q?d +,*+ /2: /2: /2: /2: mid-level (qdeohg (qdeohg2)) 8 none $oo q?d n/a /2: toggling t &. 0,1 , dd q?d q?d q?d q?d q?d q?d q?d +,*+ /2: /2: /2: /2: mid-level (qdeohg (qdeohg2)) 8 none $oo q?d i dd 2p0 precharge power- down current (slow exit) i dd 2p1 precharge power- down current (fast exit) i dd 2q precharge quiet standby current i dd 3p active power- down current
ck, ck\ cke sub-loop cs\ ras\ cas\ we\ odt ba [2:0] a [15:11] a [10] a [9:7] a [6:3] a [2:0] 10000000000 10000000000 111100000f0 111100000f0 1 2 3 4 5 6 7 cycle number command data 0 1 0d d 2d \ 3d \ repeat sub-loop 0, use ba [2:0] = 7 - - - - 4-7 8-11 repeat sub-loop 0, use ba [2:0] = 1 repeat sub-loop 0, use ba [2:0] = 2 repeat sub-loop 0, use ba [2:0] = 3 repeat sub-loop 0, use ba [2:0] = 4 repeat sub-loop 0, use ba [2:0] = 5 repeat sub-loop 0, use ba [2:0] = 6 static high toggling 12-15 16-19 20-23 24-27 28-31 logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 9: i dd 2 n / i dd 3 n m easurement l oop
ck, ck\ cke sub-loop cs\ ras\ cas\ we\ odt ba [2:0] a [15:11] a [10] a [9:7] a [6:3] a [2:0] 10000000000 10000000000 111100000f0 111100000f0 1 2 3 4 5 6 7 cycle number command data toggling static high 0 0 3 12-15 28-31 d - 1d - 2d \ - d\ - 4-7 repeat sub-loop 0, use ba [2:0] = 1; odt = 0 8-11 repeat sub-loop 0, use ba [2:0] = 2; odt = 1 repeat sub-loop 0, use ba [2:0] = 3; odt = 1 16-19 repeat sub-loop 0, use ba [2:0] = 4; odt = 0 20-23 repeat sub-loop 0, use ba [2:0] = 5; odt = 0 24-27 repeat sub-loop 0, use ba [2:0] = 6; odt = 1 repeat sub-loop 0, use ba [2:0] = 7; odt = 1 logic devices incorporated www.logicdevices.com 18 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 10: i dd 2 nt m easurement l oop
ck, ck\ cke sub-loop cs\ ras\ cas\ we\ odt ba [2:0] a [15:11] a [10] a [9:7] a [6:3] a [2:0] 01010000000 10000000000 11110000000 11110000000 010100000f0 100000000f0 111100000f0 111100000f0 1 2 3 4 5 6 7 data 0 static high toggling 56-63 0 1 2 5 8-15 cycle number command rd d d\ d\ rd 3 4 - d d\ d\ 6 7 32-39 16-23 24-31 40-47 48-55 00000000 - - - 00110011 repeat sub-loop 0, use ba [2:0] = 7 - - repeat sub-loop 0, use ba [2:0] = 1 repeat sub-loop 0, use ba [2:0] = 2 repeat sub-loop 0, use ba [2:0] = 3 repeat sub-loop 0, use ba [2:0] = 4 repeat sub-loop 0, use ba [2:0] = 5 repeat sub-loop 0, use ba [2:0] = 6 logic devices incorporated www.logicdevices.com 19 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 11: i dd 4 r m easurement l oop
ck, ck\ cke sub-loop cs\ ras\ cas\ we\ odt ba [2:0] a [15:11] a [10] a [9:7] a [6:3] a [2:0] 01001000000 10001000000 11111000000 11111000000 010010000f0 100010000f0 111110000f0 111110000f0 1 2 3 4 5 6 7 data 1d - wr toggling stac high 0 0 3 6 2d \ - 00000000 cycle number command d\ - 4wr 00110011 5d - d\ - 7d\ - 8-15 repeat sub-loop 0, use ba [2:0] = 1 16-23 repeat sub-loop 0, use ba [2:0] = 2 24-31 repeat sub-loop 0, use ba [2:0] = 3 32-39 repeat sub-loop 0, use ba [2:0] = 4 40-47 repeat sub-loop 0, use ba [2:0] = 5 48-55 repeat sub-loop 0, use ba [2:0] = 6 56-63 repeat sub-loop 0, use ba [2:0] = 7 logic devices incorporated www.logicdevices.com 20 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 12: i dd 4 w m easurement l oop
ck, ck\ cke sub-loop cs\ ras\ cas\ we\ odt ba [2:0] a [15:11] a [10] a [9:7] a [6:3] a [2:0] 0 1b 1c 1d 1e 1f 1g 1h 2 9-12 13-16 cycle number command data 1 0 17-20 21-24 25-28 29-32 33-n rfc-1 repeat sub-loop 1a, use ba [2:0] = 1 repeat sub-loop 1a, use ba [2:0] = 2 1a 2 3 4 5-8 static high toggling ref d d d\ d\ repeat sub-loop 1a, use ba [2:0] = 4 repeat sub-loop 1a, use ba [2:0] = 5 repeat sub-loop 1a, use ba [2:0] = 6 repeat sub-loop 1a, use ba [2:0] = 3 repeat sub-loop 1a, use ba [2:0] = 7 repeat sub-loop 1a through 1h until n rfc - 1, truncate if needed logic devices incorporated www.logicdevices.com 21 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 13: i dd 5 b m easurement l oop
p ackage o utline d imensions logic devices incorporated www.logicdevices.com 22 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 14: i dd m easurement l oop i dd test i dd 8: reset i dd 6e/m: self refresh current i dd 6: self refresh current ([whqghgru0lo7hpshudwxuh5dqjh t $  ?&wr?&ru?&wr?& industrial range t $  ?&wr?& &.( ([whuqdo&orfn t &. t 5& t 5$6 t 5&' t rrd t 5& &/ $/ &6? &rppdqg,qsxwv 52:&2/081dgguhvvhv %$1.dgguhvvhv data i/o 2xwsxwexiihu'4'46 odt burst length $fwlyh%$1.6 ,'/(%$1.6 srt $65 /2: 2ii&.dqg&.? /2: q?d q?d q?d q?d q?d q?d q?d q?d mid-level mid-level mid-level mid-level mid-level (qdeohg (qdeohg0lgohyho q?d q?d q?d 'lvdeohg qrupdo 'lvdeohg /2: 2ii&.dqg&.? /2: q?d q?d q?d q?d q?d q?d q?d q?d mid-level mid-level mid-level mid-level mid-level (qdeohg (qdeohg0lgohyho q?d q?d q?d (qdeohg h[whqghg 'lvdeohg mid-level mid-level q?d q?d q?d q?d q?d q?d q?d q?d mid-level mid-level mid-level mid-level mid-level mid-level mid-level q?d none $oo q?d q?d
ck, ck\ cke sub-loop cs\ ras\ cas\ we\ odt ba [2:0] a [15:11] a [10] a [9:7] a [6:3] a [2:0] 00110000000 01010001000 10000000000 001101000f0 010101010f0 100001000f0 2 3 100003000f0 5 6 7 8 100007000f0 001100000f0 010100010f0 100000000f0 00110100000 01010101000 10000100000 12 13 10000300000 15 16 17 18 10000700000 cycle number command data 1 0 2 - 00000000 - 3 n rrd n rrd + 1 n rrd + 2 n rrd + 3 2 x n rrd 3x n rrd 4 x n rrd 4 x n rrd + 1 n faw n faw + n rrd n faw + 2x n rrd n faw + 3x n rrd n faw + 4x n rrd n faw + 4x n rrd+1 2 x n faw 2 x n faw + 1 2 x n faw + 2 3 x nfaw + nrrd 3 x nfaw + 2x nrrd 2 x n faw + 3 2 x n faw + n rrd 2 x n faw + n rrd+1 2 x n faw + n rrd+2 2 x n faw + n rrd+3 2 x nfaw + 2x n rrd 1 4 9 10 11 14 static high toggling act rda d act 3 x nfaw + 3x nrrd 3 x nfaw + 4x nrrd 3 x nfaw + 4x nrrd +1 0 d act rda - repeat cycle 2 x n faw + 2 until 2 x n faw + n rrd - 1 19 2 x n faw + 3x n rrd 2 x n faw + 4x n rrd 2 x n faw+4x n rrd+1 3 x nfaw repeat sub-loop 11, use ba[2:0] = 3 - - - repeat sub-loop 1, use ba[2:0] = 5 repeat sub-loop 0, use ba[2:0] = 6 repeat sub-loop 1, use ba[2:0] = 7 repeat cycle n faw + 4 x n rrd until 2 x n faw - 1, if needed rda d - d repeat cycle 2 until n rrd - 1 repeat cycle n rrd + 2 until 2 x n rrd - 1 repeat sub-loop 0, use ba[2:0] = 2 repeat sub-loop 0, use ba[2:0] = 3 repeat cycle 4 x n rrd until n faw - 1, if needed 00110011 repeat sub-loop 10, use ba[2:0] = 2 - - rda d - 00110011 repeat sub-loop 0, use ba[2:0] = 4 d act d repeat cycle 2 x n faw + n rrd + 2 until 2 x n faw + 2 x n rrd - 1 00000000 - repeat cycle 3 x n faw + 4 x n rrd until 4 x n faw - 1, if needed repeat cycle 2 x n faw + 4 x n rrd until 3 x n faw - 1, if neede d repeat sub-loop 10, use ba[2:0] = 4 repeat sub-loop 11, use ba[2:0] = 5 repeat sub-loop 10, use ba[2:0] = 6 repeat sub-loop 11, use ba[2:0] = 7 d logic devices incorporated www.logicdevices.com 23 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 15: i dd 7 m easurement l oop
1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6  1 1 logic devices incorporated www.logicdevices.com 24 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 127(6 1. t $ = 0 &wrd 85&657dqg$65duhglvdeohghqdeolqj$65frxoglqfuhdvh, dd [e\xswrdqdgglwlrqdop$  5rrpwhpshudwxuhvhoiuhiuhvk   o &whpshudwxuhvhoiuhiuhvk  (ohydwhgwhpshudwxuhvhoiuhiuhvk7f  o &657lvglvdeohg$65lvhqdeohg9doxhlvw\slfdo  (ohydwhgwhpshudwxuhvhoiuhiuhvk o &7f o &657lvglvdeohg$65lvhqdeohg9doxhlvpd[lpxp  ([whqghgwhpshudwxuhvhoiuhiuhvk7f  o &657lvglvdeohg$65lvhqdeohg9doxhlvw\slfdo  ([whqghgwhpshudwxuhvhoiuhiuhvk o &7f ? o &657lvglvdeohg$65lvhqdeohg9doxhlvpd[lpxp i dd ddr3-1333 ddr3-1600 ddr3-1866 units notes i dd 0 i dd 1 i dd 2p0 i dd 2p1 i dd 2q i dd 2n i dd 2nt i dd 3p i dd 3n i dd 4r i dd : i dd 5b i dd 6 i dd 6 $ i dd 6 i dd (7 i dd  i dd 8 speed bin p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ t able 16a: i dd m aximum l imits v dd =1.35v 290 420 60 130 120 120  150 200 965    18.5 35 42.5  90 1065 i dd 3p$ 330 435 60 150 135 130 185 165 215 1135 815   18.5 35 42.5  90 1195 i dd 3p$ 345 455 60  150 145 200 180 230 1220 930   18.5 35 42.5  90 1330 i dd 3p$ 1 1 1 1 1 1 1 1 1 1 1 1 2 6  1 1 i dd ddr3-1333 ddr3-1600 ddr3-1866 units notes i dd 0 i dd 1 i dd 2p0 i dd 2p1 i dd 2q i dd 2n i dd 2nt i dd 3p i dd 3n i dd 4r i dd : i dd 5b i dd 6 i dd (7 i dd  i dd 8 speed bin p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ p$ t able 16b: i dd m aximum l imits v dd =1.5v 400 550 100 160 220 225 250 290 365 1200 1000 1050 110 110 140 1300 i dd 3p$ 450  100 185 235 250  315 385 1400 1125 1100 110 110 140 1450 i dd 3p$ 500 600 100 210 260  300 340 410 1500 1250 1150 110 110 140 1800 i dd 3p$
p ackage o utline d imensions p ackage o utline d imensions logic devices incorporated www.logicdevices.com 25 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 127(6 1. 9 dd dqg9 dd 4pxvwwudfnrqhdqrwkhu9 dd 4pxvwehohvvwkdqruhtxdo wr9 dd 9vv 9vv4 2. 9 dd dqg9 dd 4pd\lqfoxgh$&qrlvhri?p9 n+]wr0+] lq dgglwlrqwrwkh'& +]wrn+] vshflilfdwlrqv9 dd dqg9 dd 4pxvw ehdwwkhvdphohyhoiruydolg$&wlplqjsdudphwhuv 3. 9 5()  vhh7deoh  4. 7kh plqlpxp olplw uhtxluhphqw lv iru whvwlqj sxusrvhv  7kh ohdndjh fxuuhqwrqwkh9 5() slqvkrxogehplqlpdo parameter/condition symbol min typ max units notes supply voltage i/o supply voltage input leakage current: $q\lqsxw9d9 in d9 dd 9 5() slq9 d9 in d9 $oorwkhuslqvqrwxqghuwhvw 9 vref supply leakage current: 9 5()'4  9 dd ru9 5()&$  9 dd /2 $oorwkhuslqvqrwxqghuwhvw 9 9 9 ?$ ?$ 1,2 1,2 3,4 t able 17a: dc e lectrical c haracteristics and o perating c onditions v dd =1.35v 1.45 1.45 2 1 1.35 1.35 - - 1.3 1.3 -2 -1 $oo9rowdjhvduhuhihuhqfhgwr9vv 9 dd 9 dd q i i i 95() parameter/condition symbol min typ max units notes vin low; dc/commands/address busses vin high; dc/commands/address busses input reference voltage command/address bus i/o reference voltage dq bus i/o reference voltage dq bus in self refresh command/address termination voltage v\vwhpohyhoqrw gluhfw'5$0lqsxw 9 9 9 9 9 9 1,2 2,3 4 5 t able 18: dc e lectrical c haracteristics and i nput c onditions 6hh7deoh 9 dd [9 dd [9 dd 9 dd - n/a n/a [9 dd [9 dd [9 dd [9 dd q 9 ss 6hh7deoh [9 dd [9 dd 9 ss - $oo9rowdjhvduhuhihuhqfhgwr9vv 9 il 9 ,+ 9 5() &$ '& 9 5() '4 '& 9 5() '4 65 9 tt p ackage o utline d imensions parameter/condition symbol min typ max units notes supply voltage i/o supply voltage input leakage current: $q\lqsxw9 d9 in d9 dd 9 5() slq9 d9 in d9 $oorwkhuslqvqrwxqghuwhvw 9 vref supply leakage current: 9 5()'4  9 dd ru9 5()&$  9 dd /2 $oorwkhuslqvqrwxqghuwhvw 9 9 9 ?$ ?$ 1,2 1,2 3,4 t able 17b: dc e lectrical c haracteristics and o perating c onditions v dd =1.5v   2 1 1.5 1.5 - - 1.425 1.425 -2 -1 $oo9rowdjhvduhuhihuhqfhgwr9vv 9 dd 9 dd q i i i 95() 6hh127(6rqqh[wsdjh
p ackage o utline d imensions logic devices incorporated www.logicdevices.com 26 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product input high ac voltage: logic 1 input high ac voltage: logic 1 input high dc voltage: logic 1 input high dc voltage: logic 0 input high ac voltage: logic 0 input high ac voltage: logic 0 input high ac voltage: logic 1 input high ac voltage: logic 1 input high dc voltage: logic 1 input high dc voltage: logic 0 input high ac voltage: logic 0 input high ac voltage: logic 0    -100 -150  -   -100 -150 - 9 ,+ $& 0,1 9 ,+ $& 0,1 9 ,+ '& 0,1 9 ,/ '& 0$; 9 ,/ $& 0$; 9 ,/ $& 0$; 9 ,+ $& 0,1 9 ,+ $& 0,1 9 ,+ '& 0,1 9 ,/ '& 0$; 9 ,/ $& 0$; 9 ,/ $& 0$; 127(6 1. $ooyrowdjhvduhuhihuhqfhgwr9 5() 9 5() lv9 5()&$ irufrqwurofrp - pdqgdqgdgguhvv$oovohzudwhvdqgvhwxskrogwlphvduhvsh flilhgdw wkh'5$0edoo9 5() lv9 5()'4 iru'4dqg'0lqsxwv 2. ,qsxwvhwxswlplqjsdudphwhuv t is and t '6 duhuhihuhqfhgdw9 il $&  9 ,+ $& qrw9 5() '&  3. ,qsxwkrogwlplqjsdudphwhuv t ,+dqg t '+ duhuhihuhqfhgdw9 il '&  9 ,+ '& qrw9 5() $&  4. 6lqjohhqghg lqsxw vohz udwh  9qv pd[lpxp lqsxw yrowdjh vzl qj xqghuwhvwlvp9 shdnwrshdn  parameter/condition symbol ddr3-1866 units &rppdqgdqg$gguhvv t able 19: i nput s witching c onditions dq and dm ddr3-1600 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 ddr3-1333 127(6 1. 9 5()&$ '& lvh[shfwhgwrehdssur[lpdwho\[9 dd dqgwrwudfnydul - dwlrqvlqwkh'&ohyho([whuqdoo\jhqhudwhgshdnqrlvh qrqfrpprq prgh rq9 5()&$ pd\qrwh[fhhg?[9 dd durxqgwkh9 5()&$ '&  ydoxh3hdnwrshdn$&qrlvhrq9 5()&$ vkrxogqrwh[fhhg?ri 9 5()&$ '&  2. '&ydoxhvduhghwhuplqhgwrehohvvwkdq0+]lqiuhtxhqf\' 5$0 pxvw phhw vshflilfdwlrqv li wkh '5$0 lqgxfhv dgglwlrqdo $& qrlvh juhdwhuwkdq0+]lqiuhtxhqf\ 3. 9 5()'4 '&  lv h[shfwhg wr eh dssur[lpdwho\  [ 9 dd  dqg wr wudfn yduldwlrqvlqwkh'&ohyho([whuqdoo\jhqhudwhgshdnqrlvh qrqfrp - prq prgh  rq 95()'4 pd\ qrw h[fhhg ?  [ 9 dd around the 95()'4 '& ydoxh3hdnwrshdn$&qrlvhrq95()'4vkrxogqrw h[fhhg?ri95()'4 '&  4. 9 5()'4 '&  pd\ wudqvlwlrq wr 9 5()'4 65  dqg edfn wr 9 5()'4 '&  zkhq lq 6(/) ]5()5(6+ zlwklq uhvwulfwlrqv rxwolqhg lq wkh 6(/)  5()5(6+vhfwlrq 5. 9 tt  lv qrw dssolhg gluhfwo\ wr wkh ghylfh  9 tt  lv d v\vwhp vxsso\ iru vljqdowhuplqdwlrquhvlvwruv0,1dqg0$;ydoxhvduhv\vwhpgh shq -
notes: 1. numbers in diagrams reflect nominal values. minimum v il and v ih levels 0.850v 0.775v 0.705v 0.690v 0.675v 0.660v 0.645v 0.575v 0.500v v ih (ac) v ih (dc) v il (dc) v il (ac) v il and v ih levels with ringback 1.90v 1.35v 0.850v 0.775v 0.705v 0.690v 0.675v 0.660v 0.645v 0.575v 0.500v 0.0v -0.40v v dd q + 0.4v narrow pulse width v dd q v ih (ac) v ih (dc) v ref + ac noise v ref + dc error v ref + dc error v ref + ac noise v il (dq) v il (ac) vss vss 0.4v narrow pulse width logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product operating conditions f igure 6 - i nput s ignal
f igure 7 & 8: o vershoot /u ndershoot s pecifications maximum amplitude overshoot area v dd /v dd q time (ns) volts (v) maximum amplitude undershoot area time (ns) v ss /v ss q volts (v) figure 7: overshoot figure 8: undershoot ac overshoot/undershoot specification logic devices incorporated www.logicdevices.com 28 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product p ackage o utline d imensions p ackage o utline d imensions parameter ddr3-1333 ddr3-1600 ddr3-1866 maximum peak amplitude allowed for overshoot area vhh)ljxuh maximum peak amplitude allowed for underrshoot area vhh)ljxuh maximum overshoot area above v dd vhh)ljxuh maximum undershoot area below vss vhh)ljxuh t able 20: c ontrol and a ddress p ins 9 9 9qv 9qv parameter ddr3-1333 ddr3-1600 ddr3-1866 maximum peak amplitude allowed for overshoot area vhh)ljxuh maximum peak amplitude allowed for undershoot area vhh)ljxuh maximum overshoot area above v dd / v dd q vhh)ljxuh maximum undershoot area below vss/ vssq vhh)ljxuh t able 21: c lock , d ata , s trobe , and m ask p ins 9 9 9qv 9qv 9 9 9qv 9qv 9 9 9qv 9qv 9 9 9qv 9qv 9 9 9qv 9qv
p ackage o utline d imensions logic devices incorporated www.logicdevices.com 29 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product parameter/condition symbol min max units notes differential input voltage, logic high - slew differential input voltage, logic low - slew differential input voltage, logic high differential input voltage, logic low differential input crossing voltage relative to v dd /2 for dqs, dqs\, ck, ck\ differential input crossing voltage relative to v dd /2 for ck, ck\ single-ended high level for strobes single-ended high level for ck, ck\ single-ended low level for strobes single-ended low level for ck, ck\ p9 p9 p9 p9 p9 p9 p9 p9 4 4 5 6   5 6 t able 22: d ifferential i nput o perating c onditions (ck x , ck x \, dqs x , and dqs x \) n/a -200 9 dd 9 dd q [ 9 5() 9 il $& 9 5() '&  9 5() '&  9 dd q 9 dd 9 dd 49 il $& 9 dd /2 - 9 il $&  n/a [ 9 ,+ $& 9 5() 9 ss 9 ss q 9 5() '&  9 5() '&  9 dd 49 ,+ $& 9 dd 9 ,+ $& 9 ss q 9 ss 9 ,+ ',)) $& vohz 9 il ',)) $& vohz 9 ,+ ',)) $& 9 il ',)) $& 9 ,; 9 ,;  9 6+( 9 6(/ 127(6 1. &orfn lv uhihuhqfhg wr 9 dd ' dqg 9vv  'dwd vwureh lv uhihuhqfhg wr 9 dd 4dqg9vv4 2. 5hihuhqfhlv9 5()&$ '& iruforfndqgiru9 5()'4 '& iruvwureh 3. 'liihuhqwldolqsxwvohzudwh 9pv 4. 'hilqhvvohzudwhuhihuhqfhsrlqwvuhodwlyhwrlqsxwfurvvlqjyrowdjhv 5. 0$; olplw lv uhodwlyh wr vlqjohhqghg vljqdov wkh ryhuvkrrw vshflilfd - wlrqvduhdssolfdeoh 6. 0,1olplwlvuhodwlyhwrvlqjohhqghgvljqdovwkhxqghuvkrrwvshflilfd - wlrqvduhdssolfdeoh  7khw\slfdoydoxhri9 ,; $& lvh[shfwhgwrehderxw[9 dd riwkh wudqvplwwlqjghylfhdqg9 ,; $& lvh[shfwhgwrwudfnyduldwlrqvlq9 dd . 9 ,; $&  lqglfdwhv wkh yrowdjh dw zklfk gliihuhqwldo lqsxw vljqdov pxvw furvv 8. 7kh9 ,; h[whqghgudqjh ?p9 lvdoorzhgrqo\iruwkhforfndqgwklv  9 ,; h[whqghgudqjhlvrqo\doorzhgzkhqwkhiroorzlqjfrqglwlrqvduh phw7khvlqjohhqghglqsxwvljqdovduhprqrwrqlfkdyhwkhvl qjoh hqghgvzlqj9 6(/ 9 6(+ ridwohdvw9 dd ?p9dqgwkhgliihuhqwldo vohzudwhri&.&.?lvjuhdwhuwkdq9qv
logic devices incorporated www.logicdevices.com 30 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product overshoot/undershoot specifications f igure 9 - v ix for d ifferential s ignals v ix x x x x v dd , v dd q v dd , v dd q ck#, dqs# ck#, dqs# v ix v ix v ix ck, dqs ck, dqs v ss , v ss q v ss , v ss q v dd /2, v dd q/2 v dd /2, v dd q/2 f igure 10 - s ingle -e nded r equirements for d ifferential s ignals v ss or v ss q v dd or v dd q v sel (max) v seh (min) v seh v sel v dd /2 or v dd q/2 ck or dqs
logic devices incorporated www.logicdevices.com 31 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product overshoot/undershoot specifications f igure 11 - d efinition of d ifferential ac-s wing and t dvac v ihdiff ( ac ) min v ihdiff ( dc ) min 0.0 v ildiff ( dc ) max v ildiff (max) t dvac v ihdiff (min) v ildiff ( ac ) max half cycle t dvac ck - ck# dq s - dqs # p ackage o utline d imensions slew rate (v/ns) 350mv 300mv -4.0 4.0 3.0 2.0 1.9 1.6 1.4 1.2 1.0 <1.0 t able 23: d ifferential i nput o perating c onditions ( t dvac) for ck x , ck x \, dqs x , and dqs x \    163 162 161 159 155 150 150   50 38 34 29 22 13 0 0 %horz9 il  $& t dvac (ps) at [v ihdiff (ac) to v ildiff (ac)]
p ackage o utline d imensions input edge from to calculation setup hold t able 24: s ingle -e nded i nput s lew r ate input slew rate (linear signals) rising falling rising falling measured 9 5() 9 5() 9 il '& 0d[ 9 ,+ '& 0,1 9 ,+ $& 0,1 9 il $& 0$; 9 5() 9 5() 9 ,+ $& 0,19 5() 9 5() 9 il $& 0$; 'tfs 9 5() 9 il '& 0$; '7)+ 9 ,+ '& 0,19 5() '756+ logic devices incorporated www.logicdevices.com 32 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product slew rate definitions for single-ended input signals 6hwxs t is and t '6  qrplqdo vohz udwh iru d ulvlqj vljqdo lv ghilqhg dv wkh vohzudwhehwzhhqwkhodvwfurvvlqjri9 5() dqgwkhiluvwfurvvlqj9 ,+ $&  0,1  6hwxs t is and t '6  qrplqdo vohz udwh iru d idoolqj vljqdo lv ghilqhg dvwkhvohzudwhehwzhhqwkhodvwfurvvlqjri9 5() dqwkhiluvwfurvvlqjri 9 il $& 0$; +rog t ,+dqg t '+ qrplqdovohzudwhirudulvlqjvljqdolvghilqhgdvwkhvoh z udwhehwzhhqwkhodvwfurvvlqjri9 il '& 0$;dqgwkhiluvwfurvvlqjri9 5() . +rog t ,+dqg t '+ qrplqdovohzudwhirudidoolqjvljqdolvghilqhgdvwkhvo hz udwhehwzhhqwkhodvwfurvvlqjri9 ,+ '& 0,1dqgwkhiluvwfurvvlqjri9 5() .
logic devices incorporated www.logicdevices.com 33 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product slew rate definitions for single-ended input signals f igure 12 - n ominal s lew r ate d efinition for s ingle -e nded i nput s ignals trs tfs trh tfh v ref dq or v ref ca v ih ( ac ) min v ih ( dc ) min v il ( ac ) max v il ( dc ) max v ref dq or v ref ca v ih ( ac ) min v ih ( dc ) min v il ( ac ) max v il ( dc ) max setup hold single-ended input voltage (dq, cmd, addr) single-ended input voltage (dq, cmd, addr)
p ackage o utline d imensions input edge from to calculation ck and dqs reference t able 25: d ifferential i nput s lew r ate d efinition input slew rate (linear signals) rising falling measured 9 5() 9 5() 9 ,+ $& 0,1 9 ,/ $& 0$; 9 ,+ ',)) 0,1 - 9 il ',)) 0$; '75 ',)) 9 ,+ ',)) 0,1 9 il ',)) 0$; '7) ',)) logic devices incorporated www.logicdevices.com 34 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product slew rate definitions for differential input signals ,qsxwvohzudwhirugliihuhqwldovljqdov &.[&.[?8'46[8'46[?/'46[dqg/'46[? duhghilqhgdqgphdvxuhgdvvkrzqlq7deoh7khqrplqdovohz udwhirudulvlqjvljqdolvghilqhgdvwkhvohzudwhehwzhhq9 il ',)) 0$;dqg9 ,+ ',)) 0,17khqrplqdovohzudwhirudidoolqjvljqdolvghilqhgdvwkhvohz udwhehwzhhq9 ,+ ',)) 0,1dqg9 il ',)) 0$; f igure 13 - n ominal d ifferential i nput s lew r ate d efinition for dqs, dqs# and ck, ck# tr diff tf diff v ih ( diff ) min v il ( diff ) max 0 differential input voltage (dqs, dqs#; ck, ck#)
logic devices incorporated www.logicdevices.com 35 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product odt characteristics r tt pu r tt pd odt chip in termination mode v dd q dq v ss q i out = i pd - i pu i pu i pd i out v out to other circuitry such as rcv, . . . 2'7uv hiihfwlyh uhvlvwdqfh 5 tt  lv ghilqhg e\ 05> dqg @  2'7 lv dssolhgwrwkh'4[8'0[/'0[8'46[8'46[?/'46[dqg/'46[?  edoov7kh2'7wdujhwydoxhvduholvwhglq7deoh parameter/condition symbol min typ max units n o t e s r tt hiihfwlyhlpshgdqfh 'hyldwlrqri90zlwkuhvshfwwr9 dd q/2 % 1, 2, 4 1, 2, 3, 4 t able 26: o n -d ie t ermination dc e lectrical c haracteristics 5 r tt b()) '90 -5 6hh7deoh 127(6 1. 7rohudqfh olplwv duh dssolfdeoh diwhu d surshu =4 fdoleudwlrq kdv ehhq shuiruphgdwdvwdeohwhpshudwxuhdqgyrowdjh 9 dd 4 9 dd 9vv49vv   5hihuwrv2'76hqvlwlylw\wrqsdjhlihlwkhuwkhwhpshudwxuhruyrowdjh fkdqjhvdiwhufdoleudwlrq 2. 0hdvxuhphqwghilqlwlrqiru5 tt $sso\9 ,+ $& wrdslqxqghuwhvwdqg phdvxuhwkhfxuuhqw,>9 ,+ $& @wkhqdsso\9 il $& wrslqxqghuwhvwdqg phdvxuhfxuuhqw,>9 il $& @ 9 il $& 9 il $& ,>9,+ $& , 9 il $& @ 3. 0hdvxuhyrowdjh 90 dwwkhwhvwhgslqzlwkqrordg 4. )ru h[whqghg 0,/whps ghylfhv wkh plqlpxp ydoxhv duh ghudwhg e \ zkhqwkhghylfhlvehwzhhq?&dqg?& t $  r tt = [90 9 dd q '90 -1 x 100 f igure 14 - odt l evels and i-v c haracteristics
p ackage o utline d imensions logic devices incorporated www.logicdevices.com 36 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product mr1 [ 9 , 6 , 2 ] 0, 1, 0 0, 0, 1 0, 1, 1 1, 0, 1 1, 0, 0 t able 27: rtt e ffective i mpedances [9 dd q [9 dd q [9 dd q [9 dd q [9 dd q [9 dd q 9 il $& wr9 ,+ $& [9 dd q [9 dd q [9 dd q [9 dd q [9 dd q [9 dd q 9 il $& wr9 ,+ $& [9 dd q [9 dd q [9 dd q [9 dd q [9 dd q [9 dd q 9 il $& wr9 ,+ $& [9 dd q [9 dd q [9 dd q [9 dd q [9 dd q [9 dd q 9 il $& wr9 ,+ $& [9 dd q [9 dd q [9 dd q [9 dd q [9 dd q [9 dd q 9 il $& wr9 ,+ $& r tt resistor vout min typ max units 120 : 60: 40: 30: 20: 0.6 0.9 0.9 0.9 0.9 0.9 0.9 0.6 0.9 0.9 0.9 0.9 0.9 0.9 0.6 0.9 0.9 0.9 0.9 0.9 0.9 0.6 0.9 0.9 0.9 0.9 0.9 0.9 0.6 0.9 0.9 0.9 0.9 0.9 0.9 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.1 1.1 1.4 1.4 1.1 1.1 1.6 1.1 1.1 1.4 1.4 1.1 1.1 1.6 1.1 1.1 1.4 1.4 1.1 1.1 1.6 1.1 1.1 1.4 1.4 1.1 1.1 1.6 1.1 1.1 1.4 1.4 1.1 1.1 1.6 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 5=4 r tt 120 pd 240 r tt 120 38 240 r tt 60 pd 120 r tt 60 38 240 r tt 40 pd 80 r tt 40 38 80 r tt 30 pd 60 r tt 30 38 60 r tt 20 pd 40 r tt 20 38 40 120 : 60: 40: 30: 20:
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product odt sensitivity ,ihlwkhuwkhwhpshudwxuhruyrowdjhfkdqjhvdiwhu,2fdoleudwlrqwkhwrohudqfholplwvolvwhglq7deohfdqehh[shfwhgwrzlghqdffruglqjwr7deohvdqg symbol min max units r tt 5=4  t able 28: odt s ensitivity d efinition g5 tt g7[>'7@g5 tt g9[>'9@ 0.9 - dr tt dt x dr tt g9[>'9@ t able 29 - odt t emperature & v oltage s ensitivity change min max units dr tt dt dr tt dv 0 0 1.5 0.15 0 0 2'7ordglqjgliihuviurpwkdwxvhglq$&wlplqjphdvxuhphqwv7 zrsdudp - hwhuvghilqhzkhq2'7wxuqvrqruriiv\qfkurqrxvo\wzrghilqhzkhq2'7 wxuqvrqrurii$v\qfkurqrxvo\dqgdqrwkhughilqhvzkhq2'7wxuqvrqru riig\qdplfdoo\7deohrxwolqhvdqgsurylghvghilqlwlrqdqgphdvxuhphqw uhihuhqfhvhwwlqjviruhdfksdudphwhu 2'7 wxuqrq wlph ehjlqv zkhq wkh rxwsxw ohdyhv +,*+= dqg 2'7 uhvlv - wdqfhehjlqvwrwxuqrq2'7wxuqriiwlphehjlqvzkhqwkhrxwsxwohdyhv /2:=dqg2'7uhvlvwdqfhehjlqvwrwxuqrii odt timing definitions timing reference point dq, dm dqs, dqs# dut v ref v tt = v ss q v dd q/2 zq rzq = 240 v ss q r tt = 25 ck, ck# all rzqs are embedded in module f igure 15 - odt t iming r eference l oad
ck ck # t aon v ss q dq, dm dqs, dqs# begin point: rising edge of ck - ck# defined by the end point of odtl on v sw 1 end point: extrapolated point at v ss q t sw 1 t sw 2 ck ck # v dd q/2 t aof end point: extrapolated point at v rtt _ nom v rtt _ nom v ss q t aon t aof v sw 2 v sw 2 v sw 1 t sw 1 t sw 1 begin point: rising edge of ck - ck# defined by the end point of odtl off logic devices incorporated www.logicdevices.com 38 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product p ackage o utline d imensions symbol begin point definition end point definition figure t aon t aof t aon pd t aof pd t adc t able 30: odt t iming d efinitions figure 25 on page 59 figure 25 on page 59 figure 26 on page 60 figure 26 on page 60 )ljxuhrqsdjh ([wudsrodwhgsrlqwdw9vv4 ([wudsrodwhgsrlqwdw95 tt _norm ([wudsrodwhgsrlqwdw9vv4 ([wudsrodwhgsrlqwdw95 tt _nom ([wudsrodwhgsrlqwvdw95 tt b:5dqg95 tt _nom 5lvlqjhgjhri&.&.?ghilqhge\wkhhqgsrlqwri2'7/rq 5lvlqjhgjhri&.&.?ghilqhge\wkhhqgsrlqwri2'7/rii 5lvlqjhgjhri&.&.?zlwk2'7iluvwehlqjuhjlvwhuhg+,*+ 5lvlqjhgjhri&.&.?zlwk2'7iluvwehlqjuhjlvwhuhg/2: 5lvlqjhgjhri&.&.?ghilqhge\wkhhqgsrlqwri2'7/&1: 2'7/&:1ru2'7/&:1 p ackage o utline d imensions parameter r tt _norm setting r tt _wr_setting vsw1 vsw2 t aon t aof t aon pd t aof pd t adc t able 31: r eference s ettings for odt t iming m easurements p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 p9 n/a n/a n/a n/a n/a n/a n/a n/a 5=4 : 5=4 : 5=4 : 5=4 : 5=4 : 5=4 : 5=4 : 5=4 : 5=4 : 5=4 : measured f igure 16 - t aon and t aof d efinitions odt timing definitions
ck ck # t aonpd v ss q dq, dm dqs, dqs# begin point: rising edge of ck - ck# with odt first registered high v sw 1 end point: extrapolated point at v ss q t sw 2 ck ck # v dd q/2 t aofpd end point: extrapolated point at v rtt _ nom v rtt _ nom v ss q t aonpd t aofpd t sw 1 t sw 2 t sw 1 v sw 2 v sw 2 v sw 1 begin point: rising edge of ck - ck# with odt first registered low logic devices incorporated www.logicdevices.com 39 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product odt characteristics f igure 17 - t aonpd and t aofpd d efinition f igure 18 - t adc d efinition ck ck # t adc dq, dm dqs, dqs# end point: extrapolated point at v rtt _ nom t sw 21 t adc end point: extrapolated point at v rtt _ wr v dd q/2 v ss q v rtt _ nom v rtt _ wr v rtt _ nom t sw 11 v sw 1 v sw 2 t sw 12 t sw 22 begin point: rising edge of ck - ck# defined by the end point of odtl cnw begin point: rising edge of ck - ck# defined by the end point of odtl cnw 4 or odtl cnw 8
r on pu r on pd output driver to other circuitry such as rcv, . . . chip in drive mode v dd q v ss q i pu i pd i out v out dq logic devices incorporated www.logicdevices.com 40 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product output driver impedance f igure 19 - o utput d river 34 o hm o utput d river i mpedance the 34: gulyhu 05>@  lvwkhghidxowgulyhu8qohvvrwkhuzlvh vwdwhg doowlplqjvdqgvshflilfdwlrqvolvwhgkhuhlqdsso\wrwkh : driver only. its lpshgdqfh 5 on  lv ghilqhg e\ wkh ydoxh ri wkh h[whuqdo uhihuhqfh uhvlvwru 5=4dviroorzv5 on  5=4 zlwkqrplqdo5=4  : ? dqglvdfwx - ally 34.3 : ?7kh: rxwsxwgulyhulpshgdqfhfkdudfwhulvwlfvduholvwhg lq7deoh p ackage o utline d imensions mr1[5,1] r on resistor v out min typ max units notes 0, 1 t able 32: 34: d river i mpedance c haracteristics 5=4 5=4 5=4 5=4 5=4 5=4 % 1 1 1 1 1 1 1, 2 9 dd q 9 dd q 9 dd q 9 dd q 9 dd q 9 dd q 9 dd q 34.3: r on 34 pd r on 34 pu 0.6 0.9 0.9 0.9 0.9 0.6 -10 1.0 1.0 1.0 1.0 1.0 1.0 n/a 1.1 1.1 1.4 1.4 1.1 1.1 10 pull-up/pull-down mismatch (mm pupd ) 127(6 1. 7rohudqfholplwvdvvxph5=4ri :  ? dqgduhdssolfdeohdiwhusurshu=4fdoleudwlrqkdvehhqshuiruphgdwdvwdeohwhpshudwxuhdqgyrowdjh 9 dd 4 9 dd 9vv4 9vv 5hihuwrv2kpgulyhvhqvlwlylw\wlihlwkhuw khwhpshudwxuhruwkhyrowdjhfkdqjhvdiwhufdoleudwlrq   2. 0hdvxuhphqwghilqlwlrqiruplvpdwfkehwzhhqsxooxsdqgsxoogr zq 00 383' 0hduxuherwk5 2138 and r onpd dw[9 dd q: mm 38' = r on nom r 2138 - r onpd
logic devices incorporated www.logicdevices.com 41 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 34 o hm output driver impedance 34 o hm d river the 34: gulyhuuvfxuuhqwudqjhkdvehhqfdofxodwhgdqgvxppdul]hglq7deohiru9 dd 97deohiru9 dd 9dqg7deohiru9 dd 97kh lqglylgxdosxooxsdqgsxoogrzquhvlvwruv 5213'dqg52138 duhghilqhgdviroorzvzlwkwkh,pshgdqfh&dofxodwlrqvolvwhglq7deoh x r on 3' 9 287 >, 287 @52138lvwxuqhgrii x r on 38 9 dd 49 287 >, 287 @5213'lvwxuqhgrii p ackage o utline d imensions mr1[5,1] ron resistor vout min typ max units 0, 1 t able 33: 34 : d river p ull -u p and p ull -d own i mpedance c alculations : : : : : : 9 dd q 9 dd q 9 dd q 9 dd q 9 dd q 9 dd q 34.3: r on 34 pd r on 34 pu 2.04 30.5 30.5 30.5 30.5 20.4 34.3 34.3 34.3 34.3 34.3 34.3 38.1 38.1 48.5 48.5 38.1 38.1 242.4 34.6 240 34.3  33.9 : : r on min typ max units rzq = 240:1% rzq = (240:1%)/7 p ackage o utline d imensions mr1[5,1] r on resistor v out min typ max units 0, 1 p$ p$ p$ p$ p$ p$ i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q 34.3: r on 34 pd r on 34 pu 15.5 25.8 41.2 41.2 25.8 15.5 9.2 23 36.8 36.8 23 9.2 8.3  26 26  8.3 t able 35: 34 : d river i oh /i ol c haracteristics : v dd =v dd q=1.575v p ackage o utline d imensions mr1[5,1] r on resistor v out min typ max units 0, 1 p$ p$ p$ p$ p$ p$ i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q 34.3: r on 34 pd r on 34 pu  24.6 39.3 39.3 24.6  8.8 21.9 35 35 21.9 8.8   24.8 24.8   t able 34: 34 : d river i oh /i ol c haracteristics : v dd = v dd q = 1.5v
logic devices incorporated www.logicdevices.com 42 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 34 o hm output driver impedance p ackage o utline d imensions mr1[5,1] r on resistor v out min typ max units 0, 1 p$ p$ p$ p$ p$ p$ i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q i ol #[9 dd q 34.3: r on 34 pd r on 34 pu 14 23.3   23.3 14 8.3 20.8 33.3 33.3 20.8 8.3   23.5 23.5   t able 36: 34 : d river i oh /i ol c haracteristics : v dd =v dd q=1.425v 34: output driver sensitivity ,ihlwkhuwkhwhpshudwxuhruyrowdjhfkdqjhvdiwhu=4fdoleudwlrqwkhwrohudqfholplwvolvwhglq7deohfdqehh[shfwhgwrzlghqdffruglqjwr7deohdqg symbol min max units r on @ 0.8 x v dd q r on @ 0.5 x v dd q r on @ 0.2 x v dd q 5=4 5=4 5=4 t able 37: 34: o utput d river s ensitivity d efinition 1.1 - dr on g7+[>'7@g5 on g9+[>'9@ 1.1 - dr on dtm x ['7@g5 on g90[>'9@ 1.1 - dr on dtl x [ '7@g5 on g9/[>'9@ 0.9 - dr on g7+[>'7@g5 on g9+[>'9@ 0.9 - dr on dtm x ['7@g5 on g90[> '9@ 0.9 - dr on dtl x ['7@g5 on g9/[>'9@ change min max units dr on dtm dr on dvm dr on dtl dr on dvl dr on dth dr on dvh ?& p9 ?& p9 ?& p9 t able 38: 34: o utput d river v oltage and t emperature s ensitivity 1.5 0.13 1.5 0.13 1.5 0.13 0 0 0 0 0 0
logic devices incorporated www.logicdevices.com 43 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product alternative 40 ohm driver p ackage o utline d imensions mr1[5,1] r on resistor v out min typ max units notes 0, 1 t able 39 - 40: d river i mpedance c haracteristics 5=4 5=4 5=4 5=4 5=4 5=4 % 1 1 1 1 1 1 1, 2 9 dd q 9 dd q 9 dd q 9 dd q 9 dd q 9 dd q 9 dd q 40.0: r on 40 pd r on 40 pu 0.6 0.9 0.9 0.9 0.9 0.6 -10 1.0 1.0 1.0 1.0 1.0 1.0 n/a 1.1 1.1 1.4 1.4 1.1 1.1 10 pull-up/pull-down mismatch (mm pupd ) 127(6 1. 7rohudqfholplwvdvvxph5=4ri :  ? dqgduhdssolfdeohdiwhusurshu=4fdoleudwlrqkdvehhqshuiruphgdwdvwdeohwhpshudwxuhdqgyrowdjh 9 dd 4 9 dd 9vv4 9vv 5hihuwrv2kpgulyhvhqvlwlylw\wlihlwkhuw khwhpshudwxuhruwkhyrowdjhfkdqjhvdiwhufdoleudwlrq   2. 0hdvxuhphqwghilqlwlrqiruplvpdwfkehwzhhqsxooxsdqgsxoogr zq 00 383' 0hduxuherwk5 on 38dqg5 on 3'dw[9 dd q: mm 383' = r on nom r 2138 - r onpd x 100 40: output driver sensitivity ,ihlwkhuwkhwhpshudwxuhruyrowdjhfkdqjhvdiwhu,2fdoleudwlrqwkhwrohudqfholplwvolvwhglq7deohfdqehh[shfwhgwr zlghqdffruglqjwr7deohdqg symbol min max units r on @ 0.8 x v dd q r on @ 0.5 x v dd q r on @ 0.2 x v dd q 5=4 5=4 5=4 t able 40: 40: o utput d river s ensitivity d efinition 1.1 - dr on g7+[>'7@g5 on g9+[>'9@ 1.1 - dr on dtm x ['7@g5 on g90[>'9@ 1.1 - dr on dtl x [ '7@g5 on g9/[>'9@ 0.9 - dr on g7+[>'7@g5 on g9+[>'9@ 0.9 - dr on dtm x ['7@g5 on g90[> '9@ 0.9 - dr on dtl x ['7@g5 on g9/[>'9@
logic devices incorporated www.logicdevices.com 44 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product alternative 40 ohm driver change min max units dr on dtm dr on dvm dr on dtl dr on dvl dr on dth dr on dvh ?& p9 ?& p9 ?& p9 t able 41: 40: o utput d river v oltage and t emperature s ensitivity 1.5 0.15 1.5 0.15 1.5 0.15 0 0 0 0 0 0 output characteristics and operating conditions 7kh6'5$0xvhverwkvlqjohhqghgdqggliihuhqwldorxwsxwgulyhuv7khvlqjohhqghgrxwsxwgulyhulvvxppdul]hglq7deohzklohwkhgliihuhqwldorxwsxw gulyhulvvxppdul]hglq7deoh p ackage o utline d imensions parameter/condition symbol min max units notes output leakage current:'4duhglvdeohg 9d9 287 d9 dd 42'7lvglvdeohg2'7lv+,*+ output slew rate: 6lqjohhqghgiruulvlqjdqgidoolqj hgjhvphdvxuhehwzhhq9 ol $&  9 5() [9 dd q dqg9 2+  $&  9 5() [9 dd q single-ended dc high-level output voltage single-ended dc mid-point level output voltage single-ended dc low-point level output voltage single-ended dc high-point level output voltage single-ended dc low-point level output voltage delta r on between pull-up and pull-down for dq/dqs test load for ac timing and output slew rates x$ 9qv 9 9 9 9 9 % 1 1, 2, 3, 4 1, 2, 5 1, 2, 5 1, 2, 5 1, 2, 3, 6 1, 2, 3, 6  3 t able 42: s ingle -e nded o utput d river characteristics 5 6 10 -5 2.5 -10 i 2= 6546( 9 2+ '& 9 om '& 9 ol '& 9 2+ $& 9 ol $& mm 383' [9 dd q [9 dd q [9 dd q 977[9 dd q 977[9 dd q 2xwsxwwr9 tt  9 dd 4 yld: resistor 5. 6hh7deohrqsdjh,9fxuyholqhdulw\'rqrwxvh$&7hvwordg 6. 6hh7deohrqsdjhirurxwsxwvohzudwh  6hh7deohrqsdjhirudgglwlrqdolqirupdwlrq 8. 6hh )ljxuh  rq sdjh  iru dq h[dpsoh ri d vlqjohhqghg rxwsx w signal. 127(6 1. 5=4ri :  ? zlwk5=4hqdeohg ghidxow : gulyhu dqglvdssol - fdeoh diwhu surshu =4 fdoleudwlrq kdv ehhq shuiruphg dw d vwdeoh whp - shudwxuhdqgyrowdjh 9 dd 4 9 dd 9vv4 9vv  2. 9 tt  9 dd q/2 3. 6hh)ljxuhrqsdjhiruwkhwhvwordgfrqiljxudwlrq 4. 7kh9qvpd[lpxplvdssolfdeohirudvlqjoh'4vljqdozkhqlwlvvzlwfk - lqjiurphlwkhu+,*+wr/2:ru/2:wr+,*+zklohwkhuhpdlqlqj '4 vljqdovlqwkhvdphe\whodqhduhfrpelqdwlrqvwkhpd[lpxpolp lwri9 qvpd[lpxplvuhgxfhgwr9qv
logic devices incorporated www.logicdevices.com 45 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product p ackage o utline d imensions parameter/condition symbol min max units notes output leakage current:'4duhglvdeohg 9d9 287 d9 dd 42'7lv+,*+ output slew rate: 'liihuhqwldoiruulvlqjdqgidoolqjhgjhv phdvxuhehwzhhq9 ol ',)) $&  [9 dd 4dqg9 2+ $&  [9 dd q output differential cross-point voltage differential high-level output voltage differential low-level output voltage delta r on between pull-up and pull-down for dq/dqs test load for ac timing and output slew rates x$ 9qv p9 9 9 % 1 1 1, 2, 3 1, 4 1, 4 1, 5 3 t able 43: d ifferential o utput d river characteristics 5 12 9 5()  10 -5 5 9 5() -150 -10 i 2= srqdiff 9 2; $& 9 2+ ',)) $& 9 ol ',)) $& mm 383' [9 dd q [9 dd q 2xwsxwwr9 tt  9 dd 4 yld: resistor 4. 6hh7deohrqsdjhiruwkhrxwsxwvohzudwh 5. 6hh7deohrqsdjhirudgglwlrqdolqirupdwlrq 6. 6hh)ljxuhrqsdjhirudqh[dpsohridgliihuhqwldorxwsxwvljqdo 127(6 1. 5=4ri :  ? zlwk5=4hqdeohg ghidxow : gulyhu dqglvdssol - fdeoh diwhu surshu =4 fdoleudwlrq kdv ehhq shuiruphg dw d vwdeoh whp - shudwxuhdqgyrowdjh 9 dd 4 9 dd 9vv4 9vv  2. 9 5()  9 dd q/2 3. 6hh)ljxuhrqsdjhiruwkhwhvwordgfrqiljxudwlrq f igure 20 - dq o utput s ignal v oh ( ac ) min output max output v ol ( ac )
logic devices incorporated www.logicdevices.com 46 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 21 - d ifferential o utput s ignal v oh ( diff ) min output max output v ol ( diff ) v ox ( ac ) max v ox ( ac ) min x x x x output characteristics and operating conditions reference output load )ljxuhuhsuhvhqwvwkhhiihfwlyhuhihuhqfhordgri : xvhglqghilqlqjwkhuhohydqwghylfh$&wlplqjsdudphwhuv h[fhsw2'7uhihuhqfhwlplqj dvzhoodvwkh rxwsxwvohzudwhphdvxuhphqwv,wlvqrwlqwhqghgwrehdsuhflvhuhsuhvhqwdwlrqridsduwlfxoduv\vwhphqylurqphqwrudghslfwlrqriwkhdfwxdoordgsuhvhqwhg e\dq\vshflilf,qgxvwu\whvwv\vwhpdssdudwxv6\vwhpghvljqhuvvkrxogxvh,%,6rurwkhuvlpxodwlrqwrrovwrfruuhodwhwkhwlplqjuhihuhqfhordgsuhvhqwhgru h[klelwhgrqwkhv\vwhpruv\vwhphqylurqphqw f igure 22 - r eference o utput l oad for ac t iming and o utput s lew r ate timing reference point dq dqs dqs# dut v ref v tt = v dd q/2 v dd q/2 zq rzq = 240 v ss r tt = 25 all rzqs are embedded in module
p ackage o utline d imensions output edge from to calculation dq t able 44: s ingle -e nded o utput s lew r ate output slew rate (linear signals) rising falling measured 9 ol $& 9 2+ $& 9 2+ $& 9 ol $& 9 2+ $& 9 ol $& '756( 9 2+ $& 9 ol $&  '7)6( logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product slew rate definitions for single-ended output signals 7khvlqjohhqghgrxwsxwgulyhulvvxppdul]hglq7deoh:lwkwkhuhihuhqfhordgiruwlplqjphdvxuhphqwvwkhrxwsxwvohzudwhiruidoolqjdqgulvlqjhgjhv lvghilqhgdqgphdvxuhgehwzhhq9 ol $& dqg9 2+ $& iruvlqjohhqghgvljqdovdvlqglfdwhglq7deohdqg)ljxuh f igure 23 - n ominal s lew r ate d efinition for s ingle -e nded o utput s ignals tr se tf se v oh ( ac ) v ol ( ac ) v tt
p ackage o utline d imensions output edge from to calculation dqs, dqs\ t able 45: d ifferential o utput s lew r ate d efinition output slew rate (linear signals) rising falling measured 9 ol ',)) $& 9 2+ ',)) $& 9 2+ ',)) $& 9 ol ',)) $& 9 2+ ',)) $& 9 ol ',)) $& 'trdiff 9 2+ ',)) $& 9 ol ',)) $&  'tfdiff logic devices incorporated www.logicdevices.com 48 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product slew rate definitions for differential output signals 7khgliihuhqwldorxwsxwgulyhulvvxppdul]hglq7deoh:lwkwkhuhihuhqfhordgiruwlplqjphdvxuhphqwvwkhrxwsxwvohzudwhiruidoolqjdqgulvlqjhgjhvlv ghilqhgdqgphdvxuhgehwzhhq9 ol $& dqg9 2+ $& irugliihuhqwldovljqdovdvvkrzqlq7deohdqg)ljxuh f igure 24 - n ominal d ifferential o utput s lew r ate d efinition for dqs, dqs# tf diff v oh ( diff ) ac v ol ( diff ) ac 0
logic devices incorporated www.logicdevices.com 49 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product p ackage o utline d imensions parameter symbol min max min max min max units notes $&7,9$7(wrlqwhuqdo5($'ru:5,7(ghod\wlph 35(&+$5*(frppdqgshulrg $&7,9$7(wr$&7,9$7(ru5()5(6+frppdqgshulrg $&7,9$7(wr35(&+$5*(frppdqgshulrg &/  &/  &/  &/  6xssruwhg&/6hwwlqjv 6xssruwhg&:/6hwwlqjv 1 2 3 3 2 3 3 3 2,3 3 3 3 2,3 t able 46: s peed b ins  ''5  ''5  ''5 t 5&' t rp t 5& t 5$6 t &. $9* t &. $9* t &. $9* t &. $9* t &. $9* t &. $9* t &. $9* t &. $9* t &. $9* t &. $9* t &. $9* t &. $9* 5, 6, 8, 10 5, 6, 8, 10 5, 6, 8, 10 15 15 51 36 3 2.5  1.5 - - - pv 3.3 3.3 <2  ns ns ns ns ns ns ns ns ns ns ns ns ns ns ns ns &. &. &:/  &:/  &:/  &:/  &:/  &:/  &:/  &:/  &:/  &:/  &:/  &:/     3. 5hvhuyhg iloohgeorfnv vhwwlqjvduhqrwdoorzhg 127(6 1. t 5(),ghshqgvrq t 23(5 2. 7kh &/ dqg &:/ vhwwlqj uhvxow lq t &. uhtxluhphqwv  :khq pdnlqj d vhohfwlrqri t &.erwk&/dqg&:/uhtxluhphqwvhwwlqjvqhhgwrehixo - iloohg 15 15 51 36 3 2.5  1.5 - - - pv 3.3 3.3 <2  15 15 51 36 3 2.5  1.5 - - - pv 3.3 3.3 <2  >&:/  @>&:/ @>&:/ @ 
logic devices incorporated www.logicdevices.com 50 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 47 ( sheet 1 of 6) - e lectrical c haracteristics and ac o perating conditions min max 8 8 8 0.47 0.47 -80 -70 7800 3900 2900 0.53 0.53 80 70 -118 -140 -155 -168 -177 -186 -193 -200 -205 -210 -215 118 140 155 168 177 186 193 200 205 210 215 units notes [cwl=1.5; 10-10-10] symbol parameter -15 (ddr3-1333) 11 cycles 12 cycles 0.43 - t errnper min = (1+0.68ln[n]) x t jitper min t errnper max = (1+0.68ln[n]) x t jitper max 9,42 9,42 9,42 10,11 12 12 13 13 16 16 17 17 17 17 17 17 17 17 17 17 17 14 15 17 140 160 t errnper t jitcc t jitcc, lck t err6perr t err7perr t err8perr n = 13, 14 49, 50 cycles t err2perr t err3perr t err4perr t err5perr t err9perr t err10perr t err11perr t err12perr cumulave error across 2 cycles 3 cycles 4 cycles 5 cycles 6 cycles 7 cycles 8 cycles 9 cycles 10 cycles clock period jitter cycle-to-cycle jitter dll locked dll locking dll locked dll locking clock absolute period clock absolute high pusle width clock absolute low pulse width t clk (abs) t ckdll_dis t cl (avg) t ch (abs) t cl (abs) clock period average: dll enable mode high pulse width average low pulse width average clock period average: dll disable mode tc = 85?c to 105?c t jitper t jitper, lck t ck (avg) - 0.43 ns ck ck ps ps ps ps ps ps ps ps ps ps ps ps ps ps ps ps t ck (avg) ps ns t ck (avg) min= t ck (avg) min+ t jitper min; max= t ck (avg)max+ t jitper max tc = 0?c to <85?c tc = >105?c to 125?c t ch (avg) see speed bin table (#49) for tck range allowed [cwl=1.25; 11-11-11] -12 (ddr3-1600) [cwl=1.07; 13-13-13] -11 (ddr3-1866) min max min max 8 8 8 0.47 0.47 -70 -60 7800 3900 2900 0.53 0.53 70 60 -103 -122 -136 -147 -155 -163 -169 -175 -180 -184 -188 103 122 136 147 155 163 169 175 180 184 188 0.43 - 120 140 - 0.43 8 8 8 0.47 0.47 -60 -50 7800 3900 2900 0.53 0.53 60 50 0.43 - - 0.43 100 120 -88 -105 -117 -126 -133 -139 -145 -150 -154 -158 -161 88 105 117 126 133 139 145 150 154 158 161
logic devices incorporated www.logicdevices.com 51 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 47 ( sheet 2 of 6) - e lectrical c haracteristics and ac o perating conditions min max - data setup me to dqs, dqs\ t ds ac150 data hold me from dqs, dqs\ vref @ 1v/ns data setup me to dqs, dqs\ t ds ac175 base (speci?caon) vref @ 1v/ns base (speci?caon) vref @ 1v/ns base (speci?caon) dq high-a me from ck, ck\ dqs, dqs\ differential read postamble t rpst dqs, dqs\ differential output high me dq low-z me from ck, ck\ dq strobe input timing dqs, dqs\ differential write postamble parameter -15 (ddr3-1333) [cwl=1.5; 10-10-10] symbol dqs, dqs\ falling setup to ck, ck\ rising t dss dq output timing dqs, dqs\ to dq skew, per access dq output hold me from dqs, dqs\ t dqss dqs, dqs\ differential input low pulse width t wpst dqs,dqs\ rising to ck, ck\ rising t dqsl dqs, dqs\ differential input high pulse width t dqsh dqs, dqs\ differential read preamble t rpre dqs, dqs\ falling hold from ck, ck\ rising t dsh dqs, dqs\ differential write preamble t wpre dq strobe output timing t qsh dqs, dqs\ differential output low me t qsl dqs, dqs\ rising to/from rising ck, ck\ t dqsck dqs, dqs\ high-z me (rl+bl/2) t hz (dqs) dqs, dqs\ low-z me (rl-1) t lz (dqs) dqs, dqs\ rising to/from rising ck, ck\ when dll is disabled t dqsk dll_dis t dh ac100 minimum data pulse width t dipw t qh t dqsq - - 30 180 65 165 400 - -500 -0.25 0.45 0.45 0.2 0.2 0.9 0.3 -255 0.4 0.4 -500 - 0.9 0.3 1 0.38 - - - - - - - 125 250 250 0.25 0.55 0.55 - - - - 255 - - 250 250 note 24 note 27 10 - units ps ps ps ps ps ps ps ps ps ps ck ck ck ck ck ck ck ps ck ck ps ps ck ck ns tck (avg) 18,19 19,20 18,19 19,20 18,19 19,20 41 22,23 22,23 25 25 25 23 21 21 22,23 22,23 23,24 23,27 notes 26 21 t hz (dq) t lz (dq) -12 (ddr3-1600) [cwl=1.25; 11-11-11] -11 (ddr3-1866) [cwl=1.07; 13-13-13] min max min max - - 10 160 45 145 360 - -450 - -0.27 0.45 0.45 0.18 0.18 0.9 0.3 -225 0.4 0.4 -450 - 0.9 0.3 1 0.38 - - - - - - - 100 225 225 0.27 0.55 0.55 - - - - 225 - - 225 225 note 24 note 27 10 - dq input timing 65 200 150 275 100 200 535 - -390 - 0.38 -0.27 0.45 0.45 0.18 0.18 0.9 0.3 -195 0.4 0.4 -390 - 0.9 0.3 1 - - - - - - - 85 190 190 - 0.27 0.55 0.55 - - - - 195 - - 195 195 note 24 note 27 10
logic devices incorporated www.logicdevices.com 52 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 47 ( sheet 3 of 6) - e lectrical c haracteristics and ac o perating conditions min max - - - - - - - - - - multipurpose register read burst end to mode register set for mulpurpose register exit t mprr min = 1ck; max = n/a min = 4ck; max = n/a min = greater of 12ck or 15ns; max = n/a mode register set command cycle me t mrd min = greater of 4ck or 7.5ns; max = n/a min = 4ck; max = n/a auto precharge write recovery + precharge me t dal min = wr + t rp/ t ck (avg); max = n/a cas\-to-cas\ command delay t ccd min = 15ns; max = n/a delay from start of internal write transacon to internal read command t wtr min = greater of 4ck or 7.5ns; max = n/a write recovery me t wr mode register set command update delay t mod four activate windows for 2kb page size four activate windows for 1kb page size t faw read-to-prechare me t rtp [cwl=1.5; 10-10-10] symbol parameter -15 (ddr3-1333) command and address timing ctrl, cmd, addr setup to ck, ck\ base (speci?caon) vref @ 1v/ns ctrl, cmd, addr setup to ck, ck\ base (speci?caon) vref @ 1v/ns ctrl, cmd, addr hold to ck, ck\ base (speci?caon) vref @ 1v/ns dll locking me t dllk see "speed bin table (#49) for trcd see "speed bin table (#49) for trp see "speed bin table (#49) for tras minimum ctrl, cmd, addr pulse width t ipw activate to internal read or write delay t rcd precharge command period t rp 1kb page size activate-to-precharge command period t ras activate-to-activate command period t rcd see "speed bin table (#49) for trc min=greater of 4ck or 6ns ck ps ps ps ps ps ps ps ns ns ns ns ns ns ck ck ck ck ck ck ck ck units ck ck 28 29,30 20,30 29,30 20,30 29,30 20,30 41 31 31 31,32 31 31 31 31,32,33 31,34 notes 31 31 activate-to-activate minimum command period 2kb page size t rrd min max [cwl=1.25; 11-11-11] -12 (ddr3-1600) min max [cwl=1.07; 13-13-13] -11 (ddr3-1866) min=greater of 4ck or 6ns min=greater of 4ck or 7.5ns - - - - - - - - - - 512 65 200 150 275 100 200 535 25 35 - - - - - - - - - - min=greater of 4ck or 5ns min=greater of 4ck or 6ns t is ac175 t is ac150 t ih dc100 30 45 512 65 240 190 340 140 240 620 30 40 512 45 220 170 320 120 220 560
logic devices incorporated www.logicdevices.com 53 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 47 ( sheet 4 of 6) - e lectrical c haracteristics and ac o perating conditions min max valid clocks aer self refresh entry or power-down entry t cksre min = greater of 5ck or 10ns; max = n/a valid clocks before self refresh exit, power-down exit, or reset exit t cksrx min = greater of 5ck or 10ns; max = n/a exit self refresh to commands requiring a locked dll t xsdll min = t dllk (min); max = n/a minimum cke low pulse width for self refresh entry to self refresh exit ming t ckesr min = t cke (min) + ck; max = n/a self refresh timing exit self refresh to commands not requiring a locked dll t xs min = greater of 5ck or t rfc + 10ns; max = n/a maximum refresh period/interval tc 85?c t refi 7.8 tc >85?c 105?c 3.9 tc >105?c 125?c 2.9 tc 85?c - tc >105?c 125?c 24 tc >85?c 105?c maximum refresh period begin power supply ramp to power supplies stable t vddpr min = n/a; max = 200 refresh-to-activate or refresh command period t rfc min = 110; max = 9 x t refi refresh timing reset\ low to power supplies stable t rps min = 0; max = 200 reset\ low to i/o and rtt high-z t ioz min = n/a; max = 200 zqcs command: short calibraon time t zqcs exit reset from cke high to a valid command t xpr min = greater of 5ck or trfc + 10ns; max = n/a inializaon and reset timing 256 64 512 - - - zqcl command: long calibraon me power-up and reset operaon normal operaon t zqinit t zqoper 35 36 36 36 36 36 36 28 notes [cwl=1.5; 10-10-10] symbol calibraon timing parameter -15 (ddr3-1333) ck ck ck ms ns ms ms ms s s s ck ck ck ck ck ms ns ck units min max [cwl=1.25; 11-11-11] -12 (ddr3-1600) min max [cwl=1.07; 13-13-13] -11 (ddr3-1866) 256 64 512 - - - 256 64 512 - - - 64 (1x) 32 (2x)
logic devices incorporated www.logicdevices.com 54 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 47 ( sheet 5 of 6) - e lectrical c haracteristics and ac o perating conditions min max min = greater of 10ck or 24ns; max = n/a bl8 (otf, mrs) bc4otf t wrapden min = wl + 4 + wr + 1 min = wl + 2 + wr + 1 bl8 (otf, mrs) bc4otf t wrpden t wrpden min = wl + 4 + t wr/ t ck (avg) t wrapden bc4mrs min = wl + 2 + t wr/ t ck (avg) write with auto precharge command to power-down entry bc4mrs dll on, any valid command, or dll o? to commands not requiring dll locked t xp read/read with auto precharge commant to power-down entry t rdpden min = rl + 4 + 1 write command to power- down entry refresh command to power-down entry t refpden min = 1 mrs command to power-down entry t mrspden min = t mod (min) t actpden min = 1 precharge/precharge all command to power-down entry t prpden min = 1 command pass disable delay t cpded min = 1; max = n/a power-down entry to power-down exit ming t pd min = tcke (min); max = 60ms power-down entry period: odt eher synchronous or asynchronous pde greater of tanpd or trfc - refresh command to cke low me power-down exit period: odt either synchronous or asynchronous pdx t anpd + t xpdll greater of 3ck or 5.625ns begin power-down period prior to cke registered high t anpd wl - 1ck power-down timing power-down entry minimum timing power-down exit timing precharge power-down with dll o? to command requiring dll locked t xpdll cke min pulse width t cke (min) activate command to power-down entry parameter -15 (ddr3-1333) ck ck ck ck ck ck ck ck ck ck ck ck ck ck ck ck ck units 37 28 notes [cwl=1.5; 10-10-10] symbol min max -12 (ddr3-1600) [cwl=1.25; 11-11-11] min max -11 (ddr3-1866) [cwl=1.07; 13-13-13] min = greater of 3ck or 6.0ns; max = n/a greater of 3ck or 5ns min = 2 min = 2 min = 2 greater of 3ck or 5ns
logic devices incorporated www.logicdevices.com 55 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 47 ( sheet 6 of 6) - e lectrical c haracteristics and ac o perating conditions min max write leveling output error t wloe t wls t wlh write leveling output delay t wlo write leveling hold from rising dqs, dqs\ crossing to rising ck, ck\ crossing dqs; dqs\ delay t wldqsen write leveling setup from rising ck, ck\ crossing to rising dqs, dqs\ crossing -250 0.3 0.3 40 25 0 0 195 195 250 0.7 0.7 - - 9 2 - - 6ck + odtl off rtt dynamic change skew t adc first dqs, dqs\ rising edge t wlmrd rtt_nom-to=rtt_wr change skew odtl cnw wl - 2ck rtt_wr-to-rtt_nom change skew - bc4 odtl cnw4 4ck + odtl off rtt_wr-to-rtt_nom change skew - bc8 odtl cnw8 odt high me without write command or with write command and bc8 odt h8 min = 6; max = n/a odt high me without write command or with write command and bc4 odt h4 min = 4; max = n/a asynchronous rtt turn-off delay (power-down with dll off) t aofpd min = 2; max = 8.5 t aon rtt turn-off from odtl off reference t aof asynchronous rtt turn-on delay (power-down with dll off) t aonpd min = 2; max = 8.5 odt timing dynamic odt timing write leveling timing rtt synchronous turn-on delay odtl on rtt synchronous turn-off delay odtl o? rtt turn-on from odtl on reference parameter -15 (ddr3-1333) ck ck ps ck ck ck ck ck ck ck ns ns ps ps ck ck ns ns units 38 40 23,38 39,40 39 38 40 notes [cwl=1.5; 10-10-10] symbol min max -12 (ddr3-1600) [cwl=1.25; 11-11-11 ] min max -11 (ddr3-1866) [cwl=1.07; 13-13-13] -225 0.3 0.3 40 25 0 0 165 165 225 0.7 0.7 - - 7.5 2 - - -195 0.3 0.3 40 25 0 0 140 140 195 0.7 0.7 - - 7.5 2 - -
logic devices incorporated www.logicdevices.com 56 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product n otes 1. 3dudphwhuvduhdssolfdeohzlwk?& d t $ d ?&dqg9 dd 9 dd 4  9?9 2. $ooyrowdjhvduhuhihuhqfhgwr9vv 3. 2xwsxwwlplqjvduhrqo\ydolgiru5 on rxwsxwexiihuvhohfwlrq 4. 8qlw t &. $9*  uhsuhvhqwv wkh dfwxdo t &. $9*  ri wkh lqsxw forfn xqghurshudwlrq8qlw&.uhsuhvhqwvrqhforfnf\fohriwkhlqs xwforfn frxqwlqjwkhdfwxdoforfnhgjhv 5. $&wlplqjdqg, dd whvwvpd\xvhd9 il wr9 ,+ vzlqjrixswrp9, wkhwhvwhqylurqphqwexwlqsxwwlplqjlvvwloouhihuhqfhgwr9 5() h[fhsw t is, t ,+ t ds, and t '+xvhwkh$&'&wulssrlqwvdqg&.&.?dqg'46 '46?xvhwkhlufurvvlqjsrlqwv 7khplqlpxpvohzudwhiruwkhlqsxw vljqdovxvhgwrwhvwwkhghylfhlv9qviruvlqjohhqghglqsxwvdqg9 qvirugliihuhqwldolqsxwvlqwkhudqjhehwzhhq9 il  $& dqg9 ,+  $&  6. $oo wlplqjv wkdw xvh wlphedvhg ydoxhv qv ?v pv  vkrxog xvh t &. $9*  wr ghwhuplqh wkh fruuhfw qxpehu ri forfnv 7deoh  xvhv &. ru&. $9* lqwhufkdqjhdeo\ ,qwkhdpelhqwriqrqlqwhujhuu hvxowv dooplqlpxpolplwvduhwrehurxqghgxswrwkhqhduhvwzkrohlqwhjhu  7khxvhri6752%(ru'46',))uhihuvwrwkh'46dqg'46?glii huhq- wldofurvvlqjsrlqwzkhq'46lvwkhulvlqjhgjh7khxvhri&/2&.ru &.uhihuvwrwkh&.dqg&.?gliihuhqwldofurvvlqjsrlqwzkhq&.lvwkh rising edge. 8. 7klvrxwsxwordglvxvhgirudoo$&wlplqj h[fhsw2'7uhihuhqfhwlplqj  dqgvohzudwhv7khdfwxdo whvw ordg pd\ eh gliihuhqw  7kh r xwsxw vljqdoyrowdjhuhihuhqfhsrlqwlv9 dd 4iruvlqjohhqghgvljqdovdqg wkhfurvvlqjsrlqwirugliihuhqwldovljqdov    9. :khqrshudwlqjlq'//glvdeohprgh/2*,&'hylfhv,qf /', grhv qrwzduudqwfrpsoldqfhzlwkqrupdoprghwlplqjvruixqfwlrqdolw \  10. 7khforfnuv t &. $9* lvwkhdyhudjhforfnryhudq\frqvhfxwlyh forfnvdqg t &. $9* 0,1lvwkhvpdoohvwforfnudwhdoorzhgzlwkwkh h[fhswlrqridghyldwlrqgxhwrforfnmlwwhu,qsxwforfnmlww hulv doorzhg surylghglwgrhvqrwh[fhhgydoxhvvshflilhgdqgpxvwehridudqgrp *dxvvldqglvwulexwlrqlqqdwxuh  11. 6suhdgvshfwuxplvqrwlqfoxghglqwkhmlwwhuvshflilfdwlrqydo xhv+rz - hyhu wkh lqsxw forfn fdq dffrpprgdwh vsuhdgvshfwuxp dw d vzhh s udwhlqwkhudqjhrin+]zlwkdqgdgglwlrqdori t &. $9* dvd orqjwhupmlwwhufrpsrqhqwkrzhyhuwkhvsuhdgvshfwuxppd\qr wxvh dforfnudwhehorz t &. $9* 0,1  12. 7khforfnuv t &+ $9* dqg t &/ $9* duhwkhdyhudjhkdoiforfnshulrg ryhudq\frqvhfxwlyhforfnvdqglvwkhvpdoohvwforfnkdoishulrg doorzhgzlwkwkhh[fhswlrqriydoxhvvshflilhgdqgpxvwridudqgrp *dxvvldqglvwulexwlrqlqqdwxuh    13. 7khshulrgmlwwhu t -,73(5 lvwkhpd[lpxpghyldwlrqlqwkhforfnshulrg iurpwkhdyhudjhruqrplqdoforfn,wlvdoorzhglqhlwkhuwkhsrvlwlyhru qhjdwlyhgluhfwlrq 14. t &+ $%6 lvwkhdevroxwhlqvwdqwdqhrxvforfnkljksxovhzlgwkd vphd - vxuhgiurprqhulvlqjhgjhwrwkhiroorzlqjidoolqjhgjh  15. t &/ $%6 lvwkhdevroxwhlqvwdqwdqhrxvforfnorzsxovhzlgwkdv phd- vxuhgiurprqhidoolqjhgjhwrwkhiroorzlqjulvlqjhgjh  16. 7kh f\fohwrf\foh mlwwhu t -,7&&  lv wkh dprxqw wkh forfn shulrg fdq ghyldwhiurprqhf\fohwrwkhqh[w,wlvlpsruwdqwwrnhhsf\ fohwrf\foh mlwwhudwdplqlpxpgxulqjwkh'//orfnlqjwlph     7kh fxpxodwlyh mlwwhu huuru t (55q3(5  zkhuh q lv wkh qxpehu ri forfnvehwzhhqdqglvwkhdprxqwriforfnwlphdoorzhgwr dffx - pxodwh frqvhfxwlyho\ dzd\ iurp wkh dyhudjh forfn ryhu q qxpehu ri forfnf\fohv 18. t '6 edvh dqg t '+ edvh ydoxhvduhirudvlqjohhqghg9qv'4vohz udwhdqg9qvirugliihuhqwldo'46'46?vohzudwh 19. 7khvhsdudphwhuvduhphdvxuhgiurpdgdwdvljqdo '0'4'4 h '4qdqgvriruwk wudqvlwlrqhgjhwrlwvuhvshfwlyhgdwdvwureh vljqdo '46'46? furvvlqj 20. 7khvhwxsdqgkrogwlphvduholvwhgfrqyhuwlqjwkhedvhvshflilfdwlrq ydoxhv wrzklfkghudwlqjwdeohvdsso\ wr9 5() zkhqwkhvohzudwhlv 9qv7khvhydoxhvzlwkdvohzudwhri9qvduhiruuhihuhqfhrqo\ 21. :khq wkh ghylfh lv rshudwhg zlwk lqsxw forfn mlwwhu wklv sdudp hwhu qhhgvwrehghudwhge\wkhdfwxdo t -,73(5 odujhuri t -,73(5 0,1 ru t -,73(5 0$; riwkhlqsxwforfn rxwsxwghudwlqjvduhuhodwlyhwrwkh 6'5$0lqsxwforfn  22. 6lqjohhqghgvljqdosdudphwhu 23. 7kh6'5$0rxwsxwwlplqjlvdoljqhgwrwkhqrplqdorudyhudjhfo rfn 0rvwrxwsxwsdudphwhuvpxvwehghudwhge\wkhdfwxdomlwwhuhuuruzkhq lqsxwforfnmlwwhulvsuhvhqwhyhqzkhqzlwklqvshflilfdwlrq7klvuhvxowv lq hdfk sdudphwhu ehfrplqj odujhu  7kh iroorzlqj sdudphwhuv duh uhtxluhg wr eh ghudwhg e\ vxewudfwlqj t (553(5 0$;  t '46&. 0,1  t /= '46 0$; t /= '4 0$;dqg t $21 0$; 7khsdudph - ter t 535( 0,1 lvghudwhge\vxewudfwlqj t -,73(5 0$; zkloh t 535( 0$; lvghudwhge\ t -,73(5 0,1  24. 7khpd[lpxpsuhdpeohlverxqge\ t /='46 0$;  25. 7khvhsdudphwhuvduhphdvxuhgiurpdgdwdvwurehvljqdo '46' 46?  furvvlqjwrlwvuhvshfwlyhforfnvljqdo &.&.? furvvlqj7khvshfl - ilfdwlrq ydoxhv duh qrw diihfwhg e\ wkh dprxqw ri forfn mlwwhu dssolhg dvwkhvhduhuhodwlyhwrwkhforfnvljqdofurvvlqj7khvhsdud phwhuv vkrxogehphwzkhwkhuforfnmlwwhulvsuhvhqwruqrw 26. the t '46&.'//b',6sdudphwhuehjlqv&/$/f\fohvdiwhuwkh 5($'frppdqg  7khpd[lpxpsrvwdpeohlverxqge\ t +='46 0$;  28. &rppdqgvuhtxlulqjdorfnhg'//duh5($' dqg5'$3 dqgv\q - fkurqrxv 2'7 frppdqgv  ,q dgglwlrq diwhu dq\ fkdqjh ri odwhqf \ t ;3'//wlplqjpxvwehphw 29. t ,6 edvh dqg t ,+ edvh ydoxhvduhirudvlqjohhqghg9qvfrqwuro frppdqgdgguhvvvohzudwhdqg9qv&.&.gliihuhqwldovohzudwh 30. 7khvhsdudphwhuvduhphdvxuhgiurpdfrppdqgdgguhvvvljqdowud q- vlwlrqhgjhwrlwvuhvshfwlyhforfn &.&.? vljqdofurvvlqj7khvshfl - ilfdwlrq ydoxhv duh qrw diihfwhg e\ wkh dprxqw ri forfn mlwwhu dssolhg dv wkh vhwxs dqg krog wlphv duh uhodwlyh wr wkh forfn vljqdo furvvlqj wkdwodwfkhvwkhfrppdqgdgguhvv7khvhsdudphwhuvvkrxogehp hw zkhwkhuforfnmlwwhulvsuhvhqwruqrw7,vqhhgvwrehghudwhgehghudwhg lqfuhdvhg e\  gxh wr dgghg ordg wr wkh gulyhuv  $q dowhuqd wlyh phwkrglvwrlqfuhdvhgulyhuvwuhqjwkiru&75/&02dqg$''5 31. )ru wkhvh sdudphwhuv wkh ''5 6'5$0 ghylfh vxssruwv wq3$5$0
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product n otes c ontinued q&.   58 t 3$5$0 >qv@  t &.>$9*@>qv@  dvvxplqj doo lqsxw forfn mlwwhuvshflilfdwlrqvduhvdwlvilhg)ruh[dpsohwkhghylfhzloovxssruw t q53 q&.  58 t 53  t &.>$9*@ lidoolqsxwforfnmlwwhuvshflilfdwlrqv duhphw7klvphdqviru''5rizklfk t rp = 15ns, the ghylfhzloovxssruw t q53 58 t rp/ t &.>$9*@  dvorqjdvwkhlqsxw forfnmlwwhuvshflilfdwlrqvduhphw7kdwlvwkh35(&+$5*(frppdqg dw7dqgwkh$&7,9$7(frppdqgdw7duhydolghyhqlivl[fo rfnv duhohvvwkdqqvgxhwrlqsxwforfnmlwwhu 32. 'xulqj 5($'v dqg :5,7(v zlwk $872 35(&+$5*( wkh ''5 6'5$0 zloo krog rii wkh lqwhuqdo 35(&+$5*( frppdqg xqwlo t 5$6 0,1 kdvehhqvdwlvilhg 33. :khq rshudwlqj lq '// glvdeoh prgh wkh juhdwhu ri &. ru qv lv vdwlvilhgiru t :5 34. 7khvwduwriwkhzulwhuhfryhu\wlphlvghilqhgdviroorzv x)ru%/ il[hge\056dqg27) 5lvlqjforfnhgjhirxuforfn  f\fohvdiwhu:/ x)ru%& 27) 5lvlqjforfnhgjhirxuforfnf\fohvdiwhu:/ x)ru%& il[hge\056 5lvlqjforfnhgjhwzrforfnf\fohvd iwhu :/ 35. 5(6(7?vkrxogeh/2:dvvrrqdvsrzhuvwduwvwrudpswrhqvxuh wkhrxwsxwvduhlq+,*+=8qwlo5(6(7?lv/2:wkhrxwsxwvduhdwulvn rigulylqjwkhexvdqgfrxoguhv xowlqh[fhvvlyhfxuuhqwghshqglqjrq wkhexvdfwlylw\ 36. 7kh uhiuhvk shulrg lv pv zkhq t $  lv ohvv wkdq ru htxdo wr ?&  7klvhtxdwhvwrdqdyhudjhuhiuhvkudwhri?v+rzhyhu qlqh 5()5(6+frppdqgvvkrxogehdvvhuwhgdwohdvwrqfhhyhu\?v  :khq t $ lvjuhdwhuwkdq?&wkhuhiuhvkshulrglvpvdqgzkhq t $ lvjuhdwhuwkdq?&wkhuhiuhvkshulrglvpv  $owkrxjk &.( lv doorzhg wr eh uhjlvwhuhg /2: diwhu d 5()5(6 + frppdqgzkhq t 5()3'(1 0,1 lvvdwlvilhgwkhuhduhfdvhvzkhuh dgglwlrqdowlphvxfkdv t ;3'// 0,1 lvuhtxluhg 38. 2'7wxuqrqwlph0,1lvzkhqwkhghylfhohdyhv+,*+=dqg2'7 uhvlvwdqfh ehjlqv wr wxuq rq  2'7 wxuqrq wlph pd[lpxp lv zkhq  wkh2'7uhvlvwdqfhlvixoo\rq7kh2'7uhihuhqfhordglvvkrz qlq figure 23. 39. +doiforfnrxwsxwsdudphwhuvpxvwghudwhge\wkhdfwxdo t (553(5 and t -,7'7< zkhq  lqsxw forfn mlwwhu lv suhvhqw  7klv uhvxowv lq hdfk sdudphwhu ehfrplqj odujhu  7kh sdudphwhuv t $'& 0,1  dqg t $2) 0,1 duhhdfkuhtxluhgwrehghudwhge\vxewudfwlqjerwkw( 5- 53(5 0$;  dqg t -,7'7< 0$;   7kh sdudphwhuv t $'& 0$;  and t $2) 0$; duhuhtxluhgwrehghudwhge\vxewudfwlqjerwk t (5- 53(5 0$; dqg t -,7'7< 0$;  40. 2'7wxuqriiwlphplqlpxplvzkhqwkhghylfhvwduwvwrwxuqrii 2'7 uhvlvwdqfh2'7wxuqriiwlphpd[lpxplvzkhqwkh6'5$0exiihu  lvlq+,*+=7kh2'7uhihuhqfhordglvvkrzqlq)ljxuh7klv rxwsxwordglvxvhgiru2'7wlplqjv vhh)ljxuh  41. 3xovh zlgwk ri dq lqsxw vljqdo lv ghilqhg dv wkh zlgwk ehwzhhq wkh iluvwfurvvlqjri9 5()  '& dqgwkhfrqvhfxwlyhfurvvlqjri9 5() '&  42. 6krxogwkhforfnudwhehodujhuwkdq t 5)& 0,1 dq$8725()5(6+ frppdqg vkrxog kdyh dw ohdvw rqh 123 frppdqg ehwzhhq lw dqg dqrwkhu $872 5()5(6+ frppdqg  $gglwlrqdoo\ li wkh forfn udwh lvvorzhuwkdqqv 0+] doo5()5(6+frppdqgvvkrxogehiro - orzhge\d35(&+$5*($//frppdqg
logic devices incorporated www.logicdevices.com 58 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product command and address setup, hold, and derating the total t ,6 vhwxswlph dqg t ,+ krogwlph uhtxluhglvfdofxodwhge\dgglqjwkhgdwdvkhhw t ,6 edvh dqg t ,+ edvh ydoxhv 7deohv wrwkh ' t is and ' t ,+ ghudwlqjydoxhv 7deoh uhvshfwlyho\6hwxsdqgkrogwlphvduhedvhgrqphdvxuhphqwvdwwkhghylfh1rwhwkdwdgguhvvdqgfrqwuroslqvsuhvhqwwkh fdsdflwdqfhripxowlsohglhwrwkhv\vwhp7klvfdsdflwdqfhlvohvvwkdqwkhhtxlydohqwqxpehuriglvfuhwhghylfhvgxhwrwkhkljkhuohyhoriglhlqwhjudwlrq krzhyhulwpxvwehdffrxqwhgiruzkhqgulylqjwkhvhslqv6ohzudwhvrqwkhvhslqvzlooehvorzhuwkdqslqvzlwkrqo\rqhglhordgxqohvvphdvxuhvduhpdgh wrlqfuhdvhwkhvwuhqjwkriwkhvljqdogulyhudqgorzhuwkhwud fhlpshgdqfhsursruwlrqdoo\rqvljqdovfrqqhfwlqjwrpxowlsohlqwhuqdoglh $owkrxjkwkhwrwdovhwxswlphiruvorzvohzudwhvpljkwehqhjdwlyhdydolglqsxwvljqdolvvwloouhtxluhgwrfrpsohwhwkhwudqvlwlrqdqgwruhdfk9 ,+ $& 9 il $&  vhh)ljxuhirulqsxwvljqdouhtxluhphqwv )ruvohzudwhvzklfkidooehwzhhqwkhydoxhvolvwhglq7deohdqg7deohwkhghudwlqjydoxhvpd\ehrewdlqhg e\olqhdulqwhusrodwlrq 6hwxs t ,6 qrplqdovohzudwhirudulvlqjvljqdolvghilqhgdvwkhvohzudwhehwzhhqwkhodvwfurvvlqjri9 5() '& dqgwkhiluvwfurvvlqjri9 ,+ $& 0,16hwxs t ,6 qrplqdovohzudwhirudidoolqjvljqdolvghilqhgdvwkhvohzudwhehwzhhqwkhodvwfurvvlqjri9 5() '& dqgwkhiluvwfurvvlqjri9 il $& 0$;,iwkhdfwxdo vljqdolvdozd\vhduolhuwkdqwkhqrplqdovohzudwholqhehwzhh qwkhvkdghgv9 5() '& wr$&uhjlrqwxvhwkhqrplq dovohzudwhirughudwlqjydox h vhh)ljxuh  ,iwkhdfwxdovljqdolvodwhuwkdqwkhqrplqdovohzudwholqhdq\zkhuhehwzhhqwkhvkdghgv9 5() '& wr$&uhjlrqwwkhvohzudwhridwdqjhqwolqhwrwkh dfwxdovljqdoiurpwkh$&ohyhowrwkh'&ohyholvxvhgiruwkhghudwlqjydoxh vhh)ljxuh  +rog t ,+ qrplqdovohzudwhirudulvlqjvljqdolvghilqhgdvwkhvohzudwhehwzhhqwkhodvwfurvvlqjri9 il '& 0$;dqgwkhiluvwfurvvlqjri9 5() '& +rog t ,+ qrplqdovohzudwhirudidoolqjvljqdolvghilqhgdvwkhvohzudwhehwzhhqwkhodvwfurvvlqjri9 ,+ '& 0,1dqgwkhiluvwfurvvlqjri9 5() '& ,iwkhdfwxdo vljqdolvdozd\vodwhuwkdqwkhqrplqdovohzudwholqhehwzhhqwkhvkdghgv'&wr9 5() '& uhjlrqwxvhwkhqrplqdovohzudwhirughudwlqjydoxh vhh)ljxuh  ,iwkhdfwxdovljqdolvhduolhuwkdqwkhqrplqdovohzudwholqhdq\zkhuhehwzhhqwkhvkdghgw'&wr9 5() '& uhjlrqwwkhvohzudwhridwdqjhqwolqhwrwkh dfwxdovljqdoiurpwkh'&ohyhowrwkh9 5() '& ohyholvxvhgiruwkhghudwlqjydoxh vhh)ljxuh  symbol ddr3-800 ddr3-1066 ddr3-1333 ddr3-1600 ddr3-1866 units reference t is(base) t is(base) t ih(base)dc100 9 ,+ $& 9 il $& 9 ,+ $& 9 il $& 9 ,+ $& 9 il $& t able 48: c ommand and a ddress s etup and h old v alues r eferenced at 1v/ ns ? ac/dc based 600 600 600 600 600 - 600 600 - ps ps ps ' t is ' t ih ' t is ' t ih ' t is ' t ih ' t is ' t ih ' t is ' t ih ' t is ' t ih ' t is ' t ih ' t is ' t ih 2.0 1.5 1.0 0.9 0.8  0.6 0.5 0.4 t able 49: d erating v alues for t is/ t ih ? ac175/dc100-b ased cmd/addr slew rate v/ns 88 59 0 -2 -6 -11  -35 -62 50 34 0 -4 -10 -16 -26 -40 -60 88 50 0 -2 -6 -11  -35 -62 50 34 0 -4 -10 -16 -26 -40 -60 88 59 0 -2 -6 -11  -35 -62 50 34 0 -4 -10 -16 -26 -40 -60 96  8 6 2 -3 -9  -54 58 42 8 4 -2 -8 -18 -32 -52 96  8 6 2 -3 -9  -54 66 50 16 12 6 0 -10 -24 -44 112 83 24 22 18 13  -11 -38  58 24 20 14 8 -2 -16 -36 120 91 32 30 26 21 15 -2 -30 84 68 34 30 24 18 8 -6 -26 128 99 40 38 34 29 23 5 -22 100 84 50 46 40 34 24 10 -10 4.0v/ns 3.0v/ns 2.0v/ns 1.8v/ns 1.6v/ns 1.4v/ns 1.2v/ns 1.0v/ns ck, ck\ differential slew rate shaded cells indicate slew-rate combinations not supported ' t is, ' t ih derating (ps) - ac/dc-based, ac175 threshold; v ih (ac) = v ref (dc) + 175mv, v il (ac) = v ref (dc) - 175mv 600 600 600 - - -
logic devices incorporated www.logicdevices.com 59 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product ' t is ' t ih ' t is ' t ih ' t is ' t ih ' t is ' t ih ' t is ' t ih ' t is ' t ih ' t is ' t ih ' t is ' t ih 2.0 1.5 1.0 0.9 0.8  0.6 0.5 0.4 t able 50: d erating v alues for t is/ t ih ? ac150/dc100-b ased cmd/addr slew rate v/ns  50 0 0 0 0 -1 -10 -25 50 34 0 -4 -10 -16 -26 -40 -60  50 0 0 0 0 -1 -10 -25 50 34 0 -4 -10 -16 -26 -40 -60  50 0 0 0 0 -1 -10 -25 50 34 0 -4 -10 -16 -26 -40 -60 83 58 8 8 8 8  -2  58 42 8 4 -2 -8 -18 -32 -52 91 66 16 16 16 16 15 6 -9 66 50 16 12 6 0 -10 -24 -44 99  24 24 24 24 23 14 -1  58 24 20 14 8 -2 -16 -36  82 32 32 32 32 31 22  84 68 34 30 24 18 8 -6 -26 115 90 40 40 40 40 39 30 15 100 84 50 46 40 34 24 10 -10 4.0v/ns 3.0v/ns 2.0v/ns 1.8v/ns 1.6v/ns 1.4v/ns 1.2v/ns 1.0v/ns ck, ck\ differential slew rate ' t is, ' t ih derating (ps) - ac/dc-based, ac150 threshold; v ih (ac) = v ref (dc) + 150mv, v il (ac) = v ref (dc) - 150mv shaded cells indicate slew-rate combinations not supported slew rate (v/ns) t vac at 175mv(ps) t vac at 150mv(ps) >2.0 2.0 1.5 1.0 0.9 0.8  0.6 0.5 <0.5    163 162 161 159 155 150 150 t able 51: m inimum r equired t ime t v ac above v ih (ac) for a v alid t ransition   50 38 34 29 22 13 0 0 below vil(ac)
logic devices incorporated www.logicdevices.com 60 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. both the clock and the strobe are drawn on different time scales. v ss setup slew rate risin g signal setup slew rate falling signal ?tf ?tr = = v dd q v ih ( ac ) min v ih ( dc ) min v ref ( dc ) v il ( dc ) max v il ( dc ) max nominal slew rate v ref to ac region t vac t vac dqs dqs# ck# ck t is t ih t is t ih nominal slew rate v ref to ac region v ref ( dc ) - v il ( ac ) max ?tf v ih ( ac ) min - v ref ( dc ) ?tr f igure 25 - n ominal s lew r ate and t vac for t is (c ommand and a ddress ? c lock )
logic devices incorporated www.logicdevices.com 61 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 26 - n ominal s lew r ate for t ih (c ommand and a ddress ? c lock ) notes: 1. both the clock and the strobe are drawn on different time scales. v ss hol d slew rate falling signal hol d slew rate rising signal ?tr ?tf = = v dd q v ih ( ac ) min v ih ( dc ) min v ref ( dc ) v il ( dc ) max v il ( ac ) max nominal slew rate dc to v ref region dqs dqs# ck # ck t is t ih t is t ih dc to v ref region nominal slew rate v ref ( dc ) - v il ( dc ) max ?tr v ih ( dc ) min - v ref ( dc ) ?tf
logic devices incorporated www.logicdevices.com 62 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 27 - t angent l ine for t is (c ommand and a ddress ? c lock ) notes: 1. both the clock and the strobe are drawn on different time scales. v ss setup slew rate rising signal setup slew rate falling signal ?tf ?tr = = v dd q v ih ( ac ) min v ih ( dc ) min v ref ( dc ) v il ( dc ) max v il ( ac ) max tangent line v ref to ac region nominal line t vac t vac dqs dqs# ck # ck t is t ih t is t ih v ref to ac region tangent line nominal line tangent line (v ih [ dc ] min - v ref [ dc ]) ?tr tangent line (v ref [ dc ] - v il [ ac ] max) ?tf
logic devices incorporated www.logicdevices.com 63 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 28 - t angent l ine for t ih (c ommand and a ddress ? c lock ) notes: 1. both the clock and the strobe are drawn on different time scales. v ss hol d slew rate falling signal ?tr = v dd q v ih ( ac ) min v ih ( dc ) min v ref ( dc ) v il ( dc ) max v il ( ac ) max tangent line dc to v ref region hol d slew rate rising signal = dqs dqs # ck# ck t is t ih t is t ih dc to v ref region tangent line nominal line nominal line ?tr tangent line (v ref [ dc ] - v il [ dc ] max) ?tr tangent line (v ih [ dc ] min - v ref [ dc ]) ?tf
logic devices incorporated www.logicdevices.com 64 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product data setup, hold and derating the total t '6 vhwxswlph dqg t '+ krogwlph uhtxluhglvfdofxodwhge\dgglqjwkhgdwdvkhhw t '6 edvh dqg t '+ edvh ydoxhv vhh7deoh wrwkh ' t ds and ' t '+ghudwlqjydoxhv vhh7deoh uhvshfwlyho\ $owkrxjkwkhwrwdovhwxswlphiruvorzvohzudwhvpljkwehqhjdwlyhdydolglqsxwvljqdolvvwloouhtxluhgwrfrpsohwhwkhwudqvlwlrqdqgwruhdfk9 ,+ 9 il $& )ru vohzudwhvzklfkidooehwzhhqwkhydoxhvolvwhglq7deohwkhghudwlqjydoxhvpd\ehrewdlqhge\olqhdulqwhusrodwlrq 6hwxs t '6 qrplqdovohzudwhirudulvlqjvljqdolvghilqhgdvwkhvohzudwhehwzhhqwkhodvwfurvvlqjri9 5() '& dqgwkhiluvwfurvvlqjri9 ,+ $& 0,16hwxs t '6 qrplqdovohzudwhirudidoolqjvljqdolvghilqhgdvwkhvohzudwhehwzhhqwkhodvwfurvvlqjri9 5() '& dqgwkhiluvwfurvvlqjri9 il $& 0$;,iwkhdfwxdo vljqdolvdozd\vhduolhuwkdqwkhqrplqdovohzudwholqhehwzhhqwkhvkdghgv9 5() '& wr$&uhjlrqwxvhwkhqrplqdovohzudwhghudwlqjydoxh vhh)ljxuh   ,iwkhdfwxdovljqdolvodwhuw kdqwkhqrplqdovohzudwholqhd q\zkhuhehwzhhqwkhvkdghgv9 5() '& wr$&uhjlrqwwkhvohzudwh ridwdqjhqwolqhwrwkhdfwx do vljqdoiurpwkh$&ohyhowrwkh'&ohyholvxvhgiruwkhghudwlqjydoxh vhh)ljxuh  +rog t '+ qrplqdovohzudwhirudulvlqjvljqdolvghilqhgdvwkhvohzudwhehwzhhqwkhodvwfurvvlqjri9 il '& 0$;dqgwkhiluvwfurvvlqjri9 5() '& +rog t '+ qrplqdovohzudwhirudidoolqjvljqdolvghilqhgdvwkhvohzudwhehwzhhqwkhodvwfurvvlqjri9 ,+ '& 0,1dqgwkhiluvwfurvvlqjri9 5() '& ,iwkhdfwxdo vljqdolvdozd\vodwhuwkdqwkhqrplqdovohzudwholqhehwzhhqwkhvkdghgv'&wr9 5() '& uhjlrqwxvhwkhqrplqdovohzudwhirughudwlqjydoxh vhh)ljxuh  ,iwkhdfwxdovljqdolvhduolhuwkdqwkhqrplqdovohzudwholqhdq\zkhuhehwzhhqwkhvkdghgv'&wr9 5() '& uhjlrqwwkhvohzudwhridwdqjhqwolqhwrwkh dfwxdovljqdoiurpwkhv'&wr9 5() '& uhjlrqwlvxvhgiruwkhghudwlqjydoxh vhh)ljxuh  symbol ddr3-1333 ddr3-1600 ddr3-1866 units reference t ds(base)ac175 t ds(base)ac175 t ds(base)dc150 t ds(base)dc150 9 ,+ $& 9 il $& 9 ,+ $& 9 il $& 9 ,+ $& 9 il $& 9 ,+ $& 9 il $& t able 52: d ata s etup and h old v alues at 1v/ ns (dqs x , dqs x \ at 2v/ ns ) - ac/dc b ased - - 30 65 ps ps ps ps - - 10 45 - - 10 45 ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh 2.0 1.5 1.0 0.9 0.8  0.6 0.5 0.4 t able 53: d erating v alue for t ds/ t dh ? ac175/dc100 - b ased dq slew rate v/ns 4.0v/ns 3.0v/ns 2.0v/ns 1.8v/ns 1.6v/ns 1.4v/ns 1.2v/ns 1.0v/ns dqs, dqs# differential slew rate ? t ds, ? t dh derating (ps) ? ac175/d100-based shaded cells indicate slew-rate combinations not supported 88 59 0 50 34 0 88 59 0 -2 50 34 0 -4 88 59 0 -2 -6 50 34 0 -4 -10  8 6 2 -3 42 8 4 -2 -8 16 14 10 5 -1 16 12 6 0 -10 22 18 13  -11 20 14 8 -2 -16 26 21 15 -2 -30 24 18 8 -6 -26 29 23 5 -22 34 24 10 -10
' t ds ' t dh ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh ' t ds ' t dh 2.0 1.5 1.0 0.9 0.8  0.6 0.5 0.4 t able 54: d erating v alue for t ds/ t dh ? ac150/dc100 - b ased dq slew rate v/ns 4.0v/ns 3.0v/ns 2.0v/ns 1.8v/ns 1.6v/ns 1.4v/ns 1.2v/ns 1.0v/ns dqs, dqs# differential slew rate ? t ds, ? t dh derating (ps) ? ac150/dc100-based shaded cells indicate slew-rate combinations not supported logic devices incorporated www.logicdevices.com 65 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product  50 0 50 34 0  50 0 0 50 34 0 -4  50 0 0 0 50 34 0 -4 -10 58 8 8 8 8 42 8 4 -2 -8 16 16 16 16 15 16 12 6 0 -10 24 24 24 23 14 20 14 8 -2 -16 32 32 31 22  24 18 8 -6 -26 40 39 30 15 34 24 10 -10 slew rate (v/ns) t vac at 175mv(ps) [min] t vac at 150mv(ps) [min] >2.0 2.0 1.5 1.0 0.9 0.8  0.6 0.5 <0.5    163 162 161 159 155 150 150 t able 55: r equired t ime t vac a bove v ih (ac) (b elow v il [ac]) for a v alid t ransition   50 38 34 29 22 13 0 0
logic devices incorporated www.logicdevices.com 66 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 29 - n ominal s lew r ate and t vac for t ds (dq ? s trobe ) notes: 1. both the clock and the strobe are drawn on different time scales. v ss setup slew rate rising signal setup slew rate ?tf ?tr = = v dd q v ih ( ac ) min v ih ( dc ) min v ref ( dc ) v il ( dc ) max v il ( ac ) max nominal slew rate v ref to ac region t vac t vac t dh t ds dqs dqs# t dh t ds ck# ck v ref to ac region nominal slew rate v ih ( ac ) min - v ref ( dc ) ?tr v ref ( dc ) - v il ( ac ) max ?tf rising signal
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 30 - n ominal s lew r ate for t dh (dq ? s trobe ) notes: 1. both the clock and the strobe are drawn on different time scales. v ss hold slew rate falling signal hold slew rate rising signal ?tr ?tf = = v dd q v ih ( ac ) min v ih ( dc ) min v ref ( dc ) v il ( dc ) max v il ( ac ) max nominal slew rate dc to v ref region t dh t ds dqs dqs# t dh t ds ck# ck dc to v ref region nominal slew rate v ref ( dc ) - v il ( dc ) max ?tr v ih ( dc ) min - v ref ( dc ) ?tf
logic devices incorporated www.logicdevices.com 68 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 31 - n ominal s lew r ate and t vac for t ds (dq ? s trobe ) notes: 1. both the clock and the strobe are drawn on different time scales. v ss setup slew rate rising signal setup slew rate falling signal ?tf ?tr = = v dd q v ih ( ac ) min v ih ( dc ) min v ref ( dc ) v il ( dc ) max v il ( ac ) max tangent line v ref to ac region nominal line t vac t vac t dh t ds dqs dqs# t dh t ds ck# ck v ref to ac region tangent line nominal line ?tr tangent line (v ref [ dc ] - v il [ ac ] max) ?tf tangent line (v ih [ ac ] min - v ref [ dc ])
logic devices incorporated www.logicdevices.com 69 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 32 - n ominal s lew r ate for t dh (dq ? s trobe ) notes: 1. both the clock and the strobe are drawn on different time scales. v ss hol d slew rate falling signal ?tf ?tr = v dd q v ih ( ac ) min v ih ( dc ) min v ref ( dc ) v il ( dc ) max v il ( ac ) max tangent line dc to v ref region hol d slew rate = dqs dqs# ck# ck dc to v ref region tangent line nominal line nominal line tangent line (v ih [ dc ] min - v ref [ dc ]) ?tf tangent line (v ref [ dc ] - v il [ dc ] max) ?tr t ds t dh t ds t dh falling signal
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product p ackage o utline d imensions function symbol cycle cycle cs\ ras\ cas\ we\ ba [2:0] a n a 12 a 10 a [11,0:0] notes mode register set refresh self refresh entry self refresh exit single-bank precharge precharge all banks bank activate no operation device deselected power-down entry power-down exit zq calibration long zq calibration short 6  8 8 8 8 8 8 8 8 8 8 8 8 9 10 6 6,11 12 t able 56: t ruth t able - c ommand l l l l l l l l l l l l l l l l l l l + l l l l l l l l + + + + + + + + + + + + + ; + + l l l l l l + + + + + + + + + + + + + ; + + l + + l l + l l l l l l + + + + + + + ; l l %$ 9 9 9 9%$ 9 %$ %$ %$ %$ %$ %$ %$ %$ %$ %$ %$ %$ %$ 9 ; 9 9 ; ; 9 9 9 9 9 5)8 5)8 5)8 5)8 5)8 5)8 5)8 5)8 5)8 5)8 5)8 5)8 9 ; 9 9 ; ; 9 9 9 9 9 9 l + 9 l + 9 l + 9 l + 9 ; 9 9 ; ; 9 9 9 l + l l l + + + l l l + + + 9 ; 9 9 + l 9 9 9 9 9 5$ &$ &$ &$ &$ &$ &$ &$ &$ &$ &$ &$ &$ 9 ; 9 9 ; ; mrs 5() 65( 65; 35( 35($ $&7 :5 :56 :56 :5$3 :5$36 :5$36 rd rds4 rds8 5'$3 5'$36 5'$36 nop '(6 3'( 3'; =4&/ =4&6 + + + l + + + + + + + + + + + + + + + + + + l + + + + l + + + + + + + + + + + + + + + + + + l + + + write write with auto precharge read read with auto precharge bl8mrs %&056 %&27) bl8otf bl8mrs %&056 %&27) bl8otf bl8mrs %&056 %&27) bl8otf bl8mrs %&056 %&27) bl8otf + l l + l + 9 + 9 + 9 + + 9 + 9 + 9 + 9 + 9 + 9 cke prev next 8. %xuvw 5($'v ru :5,7(v fdqqrw eh whuplqdwhg ru lqwhuuxswhg 056 il[hg dqg27)%/%&duhghilqhglq05 9. 7khsxusrvhriwkh123frppdqglvwrsuhyhqwwkh6'5$0iurpuhj - lvwhulqjdq\xqzdqwhgfrppdqgv$123zlooqrwwhuplqdwhdqgrshud - wlrqwkdwlvlqh[hfxwlrq 10. 7kh'(6dqg123frppdqgvshuirupvlploduo\ 11. 7kh 32:(5'2:1 prgh grhv qrw shuirup dq\ 5()5(6+ rshud - tions. 12. =4 &$/,%5$7,21 /21* lv xvhg iru hlwkhu =4,17 iluvw =4&/ frp - pdqggxulqjlqlwldol]dwlrq ru=423(5 =4&/frppdqgdiwhulqlwl dol]d - wlrq  127(6 1. &rppdqgvduhghilqhge\vwdwhvri&6?5$6?&$6?:(?dqg&.( dw wkhulvlqjhgjhriwkhforfn7kh06%ri%$5$dqg&$duhghylfh ghqvlw\dqgfrqiljxudwlrqghshqghqw 2. 5(6(7?lv/2:hqdeohgdqgxvhgrqo\irudv\qfkurqrxv5(6(77k xv 5(6(7?pxvwehkhog+,*+gxulqjdq\qrupdorshudwlrq 3. 7khvwdwhri2'7grhvqrwdiihfwwkhvwdwhvghvfulehglqwklvwdeoh 4. 2shudwlrqvdsso\wrwkhedqnghilqhge\wkhedqndgguhvv)ru 056%$ vhohfwvrqhriirxuprghuhjlvwhuv 5. v9wphdqvv+wruv/w dghilqhgorjlfohyho dqgv;wphdqvv'rquw&duhw 6. 6hh7deohirudgglwlrqdolqirupdwlrqrq&.(wudqvlwlrq  6(/)5()5(6+h[lwlvdv\qfkurqrxv commands truth table
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product current state 3 power-down self refresh bank(s) active reading writing precharging refreshing all banks idle t able 57: t ruth t able - cke l + l + l l l l l l (n-1) previous cycle 4 (n) present cycle 4 (ras\, cas\, we\, cs\) command 5 action 5 notes l l l + + + + + + + v'rquw&duhw '(6ru123 v'rquw&duhw '(6ru123 '(6ru123 '(6ru123 '(6ru123 '(6ru123 '(6ru123 5()5(6+ 0dlqwdlq32:(5'2:1 32:(5'2:1h[lw 0dlqwdlq6(/)5()5(6+ 6(/)5()5(6+h[lw $fwlyh32:(5'2:1hqwu\ 32:(5'2:1hqwu\ 32:(5'2:1hqwu\ 35(&+$5*(32:(5'2:1hqwu\ 35(&+$5*(32:(5'2:1hqwu\ 6(/)5()5(6+ 1,2 1,2 1,2 1,2 1,2 1,2 1,2 1,2 1,2,6 cke 4. &.( q lvwkhorjlfvwdwhri&.(dwforfnhgjhq&.( q zd vwkh vwdwhri&.(dwwkhsuhylrxvforfnhgjh 5. &200$1'lvwkhfrppdqguhjlvwhuhgdwwkhforfnhgjh pxvwehd ohjdo frppdqg dv ghilqhg lq 7deoh    $fwlrq lv d uhvxow ri & 20- 0$1'2'7grhvqrwdiihfwwkhvwdwhvghvfulehglqwklvwdeohdqglv not listed. 6. ,gohvwdwh dooedqnvduhforvhgqrgdwdexuvwvduhlqsurjuh vv&.(lv +,*+dqgdoowlplqjviurpsuhylrxvrshudwlrqvduhvdwlvilhg$oo6(/) 5()5(6+h[lwdqg32:(5'2:1h[lwsdudphwhuvduhdovrvdwlvilhg 127(6 1. $oovwdwhvdqgvhtxhqfhvqrwvkrzqduhloohjdoruuhvhuyhgxqohvvh[solf - lwo\ghvfulehghovhzkhuhlqwklvgrfxphqw 2. t &.( 0,1 phdqv&.(pxvwehuhjlvwhuhgdwpxowlsohfrqvhfxwlyhsrvl - wlyhforfnhgjhv&.(pxvwuhpdlqdwwkhydolglqsxwohyhowkh hqwluhwlph lwwdnhvwrdfklhyhwkhuhtxluhgqxpehuriuhjlvwudwlrqforfnv 7kxvdiwhu dq\&.(wudqvlwlrq&.(pd\qrwwudqvlwlrqiurplwvydolgohyhogxulqjwkh wlphshulrgri t ,6 t &.( 0,1  t ,+ 3. &xuuhqwvwdwh 7khvwdwhriwkh6'5$0lpphgldwho\sulruwrforfnhgjh n. deselect (des) 7kh'(6frppdqg &6?+,*+ suhyhqwvqhzfrppdqgviurpehlqjh[h - fxwhge\wkh6'5$02shudwlrqvdouhdg\lqsurjuhvvduhqrwdiihfwhg no operation (nop) 7kh123frppdqg &6?/2: suhyhqwvxqzdqwhgfrppdqgviurpehlqj uhjlvwhuhg gxulqj lgoh ru zdlw vwdwhv  2shudwlrqv douhdg\ lq surjuhvv duh qrwdiihfwhg zq calibration zq calibration long (zqcl) 7kh=4&/frppdqglvxvhgwrshuirupwkhlqlwldofdoleudwlrqgxulqjdsrzhuxslqlwldol]dwlrqdqguhvhwvhtxhqfh7klvfrppdqgpd\ehlvvxhgdwdq\wlphe\ wkhfrqwuroohughshqglqjrqwkhv\vwhphqylurqphqw7kh=4&/frppdqgwuljjhuvwkhfdoleudwlrqhqjlqhlqvlghwkh6'5$0$iwhufdoleudwlrqlvdfklhyhgwkh fdoleudwhgydoxhvduhwudqvihuuhgiurpwkhfdoleudwlrqhqjlqhw rwkh6'5$0,2zklfkduhuhiohfwhgdvxsgdwhg5 on and odt values. 7kh6'5$0lvdoorzhgdwlplqjzlqgrzghilqhge\hlwkhu t =4,1,7ru t =423(5wrshuirupwkhixoofdoleudwlrqdqgwudqvihuriydoxhv :khq=4&/lvlvvxhg gxulqjwkhlqlwldol]dwlrqvhtxhqfhwkhwlplqjsdudphwhuw=4,1,7pxvwehvdwlvilhg:khqlqlwldol]dwlrqlvfrpsohwhvxevhtxhqw=4&/frppdqgvuhtxluhwkh wlplqjsdudphwhu t =423(5wrehvdwlvilhg zq calibration short (zqcs) 7kh=4&6frppdqglvxvhgwrshuirupshulrglffdoleudwlrqvwrdffrxqwiruvpdooyrowdjhdqgwhpshudwxuhyduldwlrqv7khvkruwhuwlplqjzlqgrzlvsurylghg wrshuirupwkhuhgxfhgfdoleudwlrqdqgwudqvihuriydoxhvdvghilqhge\wlplqjsdudphwhu t =4&6$=4&6frppdqgfdqhiihfwlyho\fruuhfwdplqlpxpri r on and r tt lpshgdqfhhuuruvzlwklqforfnf\fohvdvvxplqjwkhpd[lpxpvhqvlwlylwlhvvshflilhglq7deohdqg7deoh
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product activate 7kh $&7,9$7( frppdqg lv xvhg wr rshq ru $&7,9$7(  d urz lq d sduwlfxodu edqn iru d vxevhtxhqw dffhvv  7kh ydoxh rq wkh %$ > @ lqsxwvvhohfwvwkhedqndqgwkhdgguhvvsurylghgrqlqsxwv$>q @vhohfwv wkhurz7klvurzuhpdlqvrshq ru$&7,9( irudffhvvhvxqwlo d35( - &+$5*(frppdqglvlvvxhgwrwkdwedqn $35(&+$5*(frppdqgpxvwehlvvxhgehiruhrshqlqjdgliihuhqwu rz lqwkhvdphedqn read 7kh5($'frppdqglvxvhgwrlqlwldwhdexuvw5($'dffhvvwrdq $&7,9( urz  7kh dgguhvv surylghg rq lqsxwv $>@ vhohfwv wkh vwduwlqj froxpq dgguhvvghshqglqjrqwkhexuvwohqjwkdqgexuvww\shvhohfwhg vhhwdeoh  7khydoxhrqlqsxw$ghwhuplqhvzkhwkhuruqrwdxwrsuhfkdujhlv xvhg,idxwrsuhfkdujhlvvhohfwhgwkhurzehlqjdffhvvhgzl ooeh35( - &+$5*('dwwkhhqgriwkh5($'exuvw,i$87235(&+$5*(lvqrw vhohfwhgwkhurzzloouhpdlqrshqiruvxevhtxhqwdffhvvhv7k hydoxhrq lqsxw$ lihqdeohglqwkh02'(5(*,67(5 zkhqwkh5($'frppd qg lvlvvxhgghwhuplqhvzkhwkhu%& fkrs ru%/lvxvhg$iwhu d5($' frppdqglvlvvxhgwkh5($'exuvwpd\qrwehlqwhuuxswhg$v xppdu\ ri5($'frppdqgvlvvkrzqlq7deoh t able 58: r ead c ommand s ummary function symbol cycle cycle cs\ ras\ cas\ we\ ba [2:0] a n a 12 a 10 a [11,0:0] notes l l l l l l + + + + + + l l l l l l + + + + + + %$ %$ %$ %$ %$ %$ 5)8 5)8 5)8 5)8 5)8 5)8 9 l + 9 l + l l l + + + &$ &$ &$ &$ &$ &$ rd rds4 rds8 5'$3 5'$36 5'$36 + + + + + + cke prev next read read with auto precharge bl8mrs %&056 %&27) bl8otf bl8mrs %&056 %&27) bl8otf write 7kh:5,7(frppdqglvxvhgwrlqlwldwhdexuvw:5,7(dffhvvwrdq$&7,9(urz7khydoxhrqwkh%$>@lqsxwvvhohfwvwkhedqn 7khydoxhrqlqsxw$ ghwhuplqhvzkhwkhuruqrw$87235(&+$5*(lvxvhg7khydoxhrqlqsxw$ lihqdeohglqwkh02'(5(*,67(5>05@ zkhqwkh:5,7 (frppdqglv lvvxhgghwhuplqhvzkhwkhu%& fkrs ru%/lvxvhg7kh:5,7(frppdqgvxppdu\lvvkrzqlq7deoh t able 59: w rite c ommand s ummary function symbol cycle cycle cs\ ras\ cas\ we\ ba [2:0] a n a 12 a 10 a [11,0:0] notes l l l l l l + + + + + + l l l l l l l l l l l l %$ %$ %$ %$ %$ %$ 5)8 5)8 5)8 5)8 5)8 5)8 9 l + 9 l + l l l + + + &$ &$ &$ &$ &$ &$ :5 :56 :56 :5$3 :5$36 :5$36 + + + + + + cke prev next write write with auto precharge bl8mrs %&056 %&27) bl8otf bl8mrs %&056 %&27) bl8otf
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 7kh35(&+$5*(frppdqglvxvhgwr'($&7,9$7(wkhrshqurzlqd sduwlfxoduedqnrulqdooedqnv7khedqn v duhdydlodeohirudvxevhtxhqw urzdffhvvdwdvshflilhgwlph t 53 diwhuwkh35(&+$5*(frppdqglv lvvxhgh[fhswlqwkhfdvhrifrqfxuuhqw$87235(&+$5*($5($ 'ru :5,7(frppdqgwrdgliihuhqwedqnlvdoorzhggxulqjfrqfxuuhqw $872 35(&+$5*(dvorqjdvlwgrhvqrw lqwhuuxswwkhgdwdwudqvihulqwkhfxu- uhqwedqndqggrhvqrwylrodwhdq\rwkhuwlplqjsdudphwhuv,qsxw$ ghwhuplqhvzkhwkhurqhrudooedqnvduhsuhfkdujhg,qwkhfdv hzkhuh rqo\rqhedqnlvuhfkdujhg,qsxwv%$>@vhohfwwkhedqnrwkhuzlvh %$>@duhwuhdwhgdvv'rquw&duhw$iwhudedqnlv35(&+$5*( 'lwlv lqwkhlgohvwdwhdqgpxvwehdfwlydwhgsulruwrdq\5($'ru:5 ,7(frp- pdqgvehlqjlvvxhgwrwkdwedqn$35(&+$5*(frppdqglvwuhdwh g dvd123liwkhuhlvqrrshqurzlqwkdwedqn lgohvwdwh rul iwkhsuhyl - rxvo\rshqurzlvdouhdg\lqwkhsurfhvvrisuhfkdujlqj+rzhy huwkh 35(&+$5*(shulrglvghwhuplqhge\wkhodvw35(&+$5*(frppdqg lvvxhgwrwkhedqn precharge 5()5(6+lvxvhggxulqjqrupdorshudwlrqriwkh6'5$0dqglvdqd orjrxv wr&$6?ehiruh5$6? &%5 uhiuhvkru$8725()5(6+7klvfrppdq g lvqrqshuvlvwhqwvrlwpxvwehlvvxhghdfkwlphd5()5(6+lvuhtxluhg  7kh dgguhvvlqj lv jhqhudwhg e\ wkh lqwhuqdo 5()5(6+ frppdqg  7 kh 6'5$0uhtxluhv5()5(6+f\fohvdwdqdyhudjhlqwhuydori?v pd[l - pxpzkhq7 $ d ?&ru?v0$;zkhq7 $ d ?& 7kh5()5(6+shulrg ehjlqvzkhqwkh5()5(6+frppdqglvuhjlvwhuhgdqghqgv t 5)& 0,1  later. 7rdoorzirulpsuryhghiilflhqf\lqvfkhgxolqjdqgvzlwfklqjeh wzhhqwdvnv vrphioh[lelolw\lqwkhdevroxwh5()5(6+lqwhuydolvsurylghg $pd[lpxp rihljkw5()5(6+frppdqgvfdqehsrvwhgwrdq\jlyhq6'5$0phd q- lqjwkdwwkhpd[lpxpdevroxwhlqwhuydoehwzhhqdq\5()5(6+frpp dqg dqg wkh qh[w 5()5(6+ frppdqg lv qlqh wlphv wkh pd[lpxp dyhudjh lqwhuydo uhiuhvk udwh  6(/) 5()5(6+ pd\ eh hqwhuhg zlwk xs wr hljkw 5()5(6+frppdqgvehlqjsrvwhg$iwhuh[lwlqj6(/)5()5(6+ zkh q hqwhuhgzlwksrvwhg5()5(6+frppdqgv dgglwlrqdosrvwlqjri5()5(6+ frppdqgv lv doorzhg wr wkh h[whqw wkh pd[lpxp qxpehu ri fxpxodw lyh srvwhg5()5(6+frppdqgv erwksuhdqgsrvw6(/)5()5(6+ grhv qrwh[fhhghljkw5()5(6+frppdqgv refresh f igure 33 - r efresh m ode notes: 1. nop commands are shown for ease of illustration; other valid commands may be possible at these times. cke must be active during the precharge, activate, and refresh commands, but may be inactive at other times (see power-down mode on page 153). nop 1 nop 1 nop 1 pre ra bank(s) 3 ba ref nop 1 ref 2 nop 1 act nop 1 one bank all banks t ck t ch t cl ra t rfc 2 t rp t rfc (min) t0 t1 t2 t3 t4 ta0 tb0 ta1 tb 1 tb2 dont care indicates a break in time scale valid 1 valid 1 valid 1 ck ck# command cke address a10 ba[2:0] dq 4 dm 4 dqs, dqs# 4
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 7kh6(/)5()5(6+frppdqglvxvhgwruhwdlqgdwdlqwkh6'5$0hyhqliwkhuhvwriwkhv\vwhplvsrzhuhggrzq:khqlqwkh6(/)5()5(6+prghwkh 6'5$0uhwdlqvgdwdzlwkrxwh[whuqdoforfnlqj7kh6(/)5()5(6+ prghlvdovrdfrqyhqlhqwphwkrgxvhgwrhqdeohglvdeohwkh'/ /dvzhoodvwrfkdqjh wkhforfniuhtxhqf\zlwklqwkhdoorzhgv\qfkurqrxvrshudwlqjudqjh$oosrzhuvxsso\lqsxwv lqfoxglqj9 5()&$ dqg9 5()'4 pxvwehpdlqwdlqhgdwydolgohyhov xsrqhqwu\h[lwdqggxulqj6(/)5()5(6+prghrshudwlrq$oosrzhuvxsso\lqsxwv lqfoxglqj9 5()&$ dqg9 5()'4 pxvwehpdlqwdlqhgdwydolgohyhovxsrq hqwu\h[lwdqggxulqj6(/)5()5(6+prghxqghufhuwdlqfrqglwlrq v x9vv9 5()'4 9 dd lvpdlqwdlqhg x9 5()'4 lvydolgdqgvwdeohsulruwr&.(jrlqjedfn+,*+ x7khiluvw:5,7(rshudwlrqpd\qrwrffxuhduolhuwkdqforfnvdiwhu9 5()'4 is valid x$oorwkhu6(/)5()5(6+prghh[lwwlphuhtxluhphqwvduhphw self refresh ,iwkh'//lvglvdeohge\wkh02'(5(*,67(5 05>@fdqehvzlwfkhggxulqjlqlwldol]dwlrqruodwhu wkh6'5$0lvwdujhwhgex wqrwjxdudqwhhgwrrshudwh vlploduo\wrwkh1250$/prghzlwkdihzqrwdeohh[fhswlrqv x 7kh6'5$0vxssruwvrqo\rqhydoxhri&$6odwhqf\ &/  dqgr qhydoxhri&$6:5,7(odwhqf\ &:/   x '//',6$%/(prghdiihfwvwkh5($'gdwdforfnwrgdwdvwurehuhodwlrqvkls t '46&. exwqrwwkh5($'gdwdwrgdwdvwurehuhodwlrqvkls t dqsq, t 4+ 6shfldodwwhqwlrqlvqhhghgwrolqhwkh5($'gdwdxszlwkwkhfrqwuroohuwlphgrpdlqzkhqwkh'//lvglvdeohg x ,q1250$/rshudwlrq '//rq  t '46&.vwduwviurpwkhulvlqjforfnhgjh$/&/f\fohvdiwhuwkh5($'frppdqg,q'//',6$%/( prgh t '46&.vwduwv$/ &/yf\fohvdiwhuwkh5($'frppdqg$gglwlrqdoo\zlwkwkh'//glvdeohgwkhydoxhri t '46&.frxogeh larger than t &. 7kh2'7ihdwxuhlvqrwvxssruwhggxulqj'//',6$%/(prgh lqfoxglqjg\qdplf2'7 7kh2'7uhvlvwruvpxvwehglvdeohge\frqwlqxrxvo\uhjlvwhulqjwkh 2'7edoo/2:e\surjudpplqj5 tt _norm mr1[9,6,2] and r tt b:505>@wrvwzklohlq'//',6$%/(prgh 6shflilfvwhsvpxvwehiroorzhgwrvzlwfkehwzhhqwkh'//hqdeohdqg'//',6$%/(prghvgxhwrdjdslqwkhdoorzhgforfnudwhvehwzhhqwkhwzrprghv t &.>$9*@0$;dqg t &.>'//',6$%/(@0,1uhvshfwlyho\ 7khrqo\wlphwkhforfnlvdoorzhgwrfurvvwklvforfnudwhjdslvgxulqj6(/)5()5(6+pr gh 7kxvwkhuhtxluhgsurfhgxuhiruvzlwfklqjiurpwkh'//(1$%/(wr'//',6$%/(prghlvwrfkdqjhiuhtxhqf\fxulqjvhoiuhiuhvk vhh)ljxuh  1. 6wduwlqjiurpwkh,'/(vwdwh dooedqnvduh35(&+$5*('doowlplqjvduhixoiloohg2'7lvwxuqhgriidqg5 tt _nom and r tt b:5duh +,*+= vhw05>@wrvwwr',6$%/(wkh'// 2. (qwhu6(/)5()5(6+prghdiwhu t 02'kdvehhqvdwlvilhg 3. $iwhu t &.65(lvvdwlvilhgfkdqjhwkhiuhtxhqf\wrwkhghvluhgforfnudwh 4. 6(/)5()5(6+pd\ehh[lwhgzkhqwkhforfnlvvwdeohgzlwkwkhqhziuhtxhqf\iru t &.65; 5. 7kh6'5$0zlooehuhdg\irulwvqh[wfrppdqglqwkh'//',6$%/(prghdiwhuwkhjuhdwhuri t mrd or t 02'kdvehhqvdwlvilhg$=4&/ frppdqgvkrxogehlvvxhgzlwkdssursuldwhwlplqjphwdvzhoo dll disable mode
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 34 - dll e nable m ode to dll d isable m ode command t0 t1 ta0 ta1 tb 0 tc0 7 6 td 0 td 1 te0 te1 tf0 ck ck# odt 9 vali d 1 don t care vali d 1 sre 3 nop mrs 2 nop srx 4 mrs 5 vali d 1 nop nop indicates a break in time scale t mod t cksre t mod t xs t ckesr cke t cksrx 8 127(6 1. $q\ydolgfrppdqg 2. 'lvdeoh'//e\vhwwlqj05>@wrvw 3. :dlw t ;6wkhqvhw05>@wrvwwrhqdeoh'// 4. :dlw t 05'wkhqvhw05>@wrvwwrehjlq'//5(6(7 5. :dlw t 05'xsgdwhuhjlvwhuv &/&:/dqgzulwhuhfryhu\pd\ehqhfhvvdu\  6. :dlw t 02'dq\ydolgfrppdqg  6wduwlqjzlwkwkhlgohvwdwh 8. &kdqjhiuhtxhqf\ 9. &orfnpxvwehvwdeohdwohdvw t &.65; 10. 6wdwlf/2:lqfdvh5 tt _nom or r tt b:5lvhqdeohgrwkhuzlvhvwdwlf/2:ru+,*+ $vlplodusurfhgxuhlvuhtxluhgiruvzlwfklqjiurpwkh'//glvdeohprghedfnwrwkh'//hqdeohprgh7klvdovruhtxluhvfkdqjlqjwkhiuhtxhqf\gxulqjvhoi uhiuhvkprgh vhh)ljxuhrqsdjh  6wduwlqjiurpwkhlgohvwdwh dooedqnvduhsuhfkdujhgdoowlplqjvduhixoiloohg2'7lvwxuqhgriidqg5 tt _nom and r tt b:5duh+ljk=  hqwhuvhoiuhiuhvkprgh $iwhu t &.65(lvvdwlvilhgfkdqjhwkhiuhtxhqf\wrwkhqhzforfnudwh 6hoiuhiuhvkpd\ehh[lwhgzkhqwkhforfnlvvwdeohzlwkwkhqhziuhtxhqf\iru t &.65;$iwhu t ;6lvvdwlvilhgxsgdwhwkhprghuhjlvwhuv zlwkwkhdssursuldwhydoxhv$wdplqlpxpvhw05>@wrvwwrhqdeohwkh'//:dlw t 05'wkhqvhw05>@wrvwwrhqdeoh'//5(6(7 $iwhudqrwkhu t 05'ghod\lvvdwlvilhgwkhqxsgdwhwkhuhpdlqlqjprghuhjlvwhuvzlwkwkhdssursuldwhydoxhv 7kh'5$0zlooehuhdg\irulwvqh[wfrppdqglqwkh'//hqdeohprghdiwhuwkhjuhdwhuri t mrd or t 02'kdvehhqvdwlvilhg+rzhyhu ehiruhdsso\lqjdq\frppdqgruixqfwlrquhtxlulqjdorfnhg'//dghod\ri t '//.diwhu'//5(6(7pxvwehvdwlvilhg$=4&/frppdqg vkrxogehlvvxhgzlwkwkhdssursuldwhwlplqjvphwdvzhoo
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 35- dll d isable m ode to dll e nable m ode indicates a break in time scale t c t dllk cke t0 t a 0t a 1tb0 t c 0t c 1td0t e 0 tf0 t g 0 ck ck# odt 10 sre 1 nop command nop srx 2 mrs 3 mrs 4 mrs 5 vali d 6 vali d don t care 8 7 t ck sr e th0 t cksrx 9 odtl off + 1 t ck t xs t mrd t mrd kesr 127(6 1. (qwhu6(/)5()5(6+ 2. ([lw6(/)5()5(6+ 3. :dlw t ;6wkhqvhw05>@wrvwwrhqdeoh'// 4. :dlw t 05'wkhqvhw05>@wrvwwrehjlq'//5(6(7 5. :dlw t 05'xsgdwhuhjlvwhuv &/&:/dqgzulwhuhfryhu\pd\ehqhfhvvdu\  6. :dlw t 02'dq\ydolgfrppdqg  6wduwlqjzlwkwkhlgohvwdwh 8. &kdqjhiuhtxhqf\ 9. &orfnpxvwehvwdeohdwohdvw t &.65; 10. 6wdwlf/2:lqfdvh5 tt _nom or r tt b:5lvhqdeohgrwkhuzlvhvwdwlf/2:ru+,*+ 7khforfniuhtxhqf\udqjhiruwkh'//glvdeohprghlvvshflilhge\wkhsdudphwhu t &.'//b',6'xhwrodwhqf\frxqwhudqgwlplqjuhvwulfwlrqvrqo\&/  dqg&:/ duhvxssruwhg '//glvdeohprghzloodiihfwwkhuhdggdwdforfnwrgdwdvwurehuhodwlrqvkls t '46&. exwqrwwkhgdwdvwurehwrgdwduhodwlrqvkls t dqsq, t 4+ 6shfldodwwhq - wlrqlvqhhghgwrwkhfrqwuroohuwlphgrpdlq &rpsduhgwrwkh'//rqprghzkhuh t '46&.vwduwviurpwkhulvlqjforfnhgjh$/&/f\fohvdiwhuwkh5($'frppdqgwkh'//glvdeohprgh t '46&. vwduwv$/&/f\fohvdiwhuwkh5($'frppdqg vhh)ljxuhrqsdjh  :5,7(rshudwlrqvixqfwlrqvlploduo\ehwzhhqwkh'//hqdeohdqg'//glvdeohprghvkrzhyhu2'7ixqfwlrqdolw\lvqrwdoorzhgzlwk'//glvdeohprgh
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 36 - dll d isable t dqsck t iming t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 don t care transitioning data vali d nop read nop nop nop nop nop nop nop nop nop ck ck # command add ress di b + 3 di b + 2 di b + 1 di b di b + 7 di b + 6 di b + 5 di b + 4 dq bl8 dll on dqs, dqs# dll on dq bl8 dll disable dqs, dqs# dll off dq bl8 dll disable dqs, dqs# dll off rl = al + c l = 6 (c l = 6, al = 0) c l = 6 di b + 3 di b + 2 di b + 1 di b di b + 7 di b + 6 di b + 5 di b + 4 di b + 3 di b + 2 di b + 1 di b di b + 7 di b + 6 di b + 5 di b + 4 t dqsck ( dll _ dis ) min t dqsck ( dll _ dis ) max rl (dll disable) = al + (c l - 1) = 5 :khqwkh''56'5$0lvlqlwldol]hglwuhtxluhvwkhforfnwreh vwdeohgxulqjprvw1250$/vwdwhvrirshudwlrq7klvphdqvwkdwdiwhuwkhforfniuhtxhqf\ kdvehhqvhwwrwkhvwdeohvwdwhwkhforfnshulrglvqrwdoorzhgwrghyldwhh[fhswzkdwlvdoorzhgirue\wkhforfnmlwwhudqgvsuhdgvshfwuxpforfnlqj 66&  vshflilfdwlrqv 7khlqsxwforfniuhtxhqf\fdqehfkdqjhgiurprqhvwdeohforfnudwhwrdqrwkhuxqghuwzrfrqglwlrqv6(/)5()5(6+prghdqg35( &+$5*(srzhugrzq prgh2xwvlghriwkhvhwzrprghvlwlvloohjdowrfkdqjhwkh forfniuhtxhqf\)ruwkh6(/)5()5(6+prghfrqglwlrqzkhqwkh ''56'5$0kdvehhq vxffhvvixoo\sodfhglqwr6(/)5()5(6+prghdqg t &.65(kdvehhqvdwlvilhgwkhvwdwhriwkhforfnehfrphvdv'rquw&duhw:khqwkhforfnehfrphvd v'rquw&duhwfkdqjlqjwkhforfniuhtxhqf\lvshuplvvleohsurylghgwkhqhzforfniuhtxhqf\lvvwdeohsulruwr t &.65;:khqhqwhulqjdqgh[lwlqjvhoiuhiuhvk prghiruwkhvrohsxusrvhrifkdqjlqjwkhforfniuhtxhqf\wkh 6(/)5()5(6+hqwu\dqgh[lwvshflilfdwlrqvpxvwvwlooehphw 7kh35(&+$5*(srzhugrzqprghfrqglwlrqlvzkhqwkh''56'5$0lvlq35(&+$5*(srzhugrzqprgh hlwkhuidvwh[lwprghruvorz h[lwprgh  (lwkhu2'7pxvwehdwdorjlf/2:ru5 tt _nom and r tt b:5pxvwehglvdeohgyld05dqg057klvhqvxuhv5 tt _nom and r tt b:5duhlqdqriivwdwh sulruwrhqwhulqj35(&+$5*(srzhugrzqprghzklohpdlqwdlqlqj& .(dwdorjlf/2:$plqlpxpri t &.65(pxvwrffxudiwhu&.(jrhv/2:ehiruhwkh forfniuhtxhqf\fdqfkdqjh7kh''56'5$0lqsxwforfniuhtxhqf\lvdoorzhgwrfkdqjhrqo\zlwklqwkhplqlpxpdqgpd[lpxprshudwlqjiuhtxhqf\vshfl - ilhgiruwkhsduwlfxoduvshhgwhpshudwxuhjudgh t &.>$9*@0,1wr t &.>$9*@0$; ghylfh'xulqjwkhlqsxwforfniuhtxhqf\fkdqjh&.(pxvwehkhogdwd vwdeoh/2:ohyho:khqwkhlqsxwforfniuhtxhqf\lvfkdqjhgdvwdeohforfnpxvwehsurylghgwrwkh6'5$0 t &.65;ehiruh35(&+$5*(srzhugrzqpd\ ehh[lwhg$iwhu35(&+$5*(srzhugrzqlvh[lwhgdqg t ;3kdvehhqvdwlvilhgwkh'//pxvwehuhvhwyldwkh056'hshqglqjrqwkhqhzforfniuhtxhqf\ dgglwlrqdo056frppdqgvpd\qhhgwrehlvvxhg'xulqjwkh'// orfnwlph5 tt _nom and r tt b:5pxvwuhpdlqlqdqriivwdwh$iwhuwkh'//orfnwlph wkh6'5$0lvuhdg\wrrshudwhzlwkdqhzforfniuhtxhqf\ shulrg 7klvsurfhvvlvghslfwhglq)ljxuh input clock frequency change
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 37- c hange f requency d uring p recharge p ower -d own ck ck# command nop nop nop address cke dq dm dqs, dqs# nop t ck enter precharge power-down mode exit precharge power-down mode t0 t1 ta0 tc0 tb0 t2 dont care t cke t xp mrs dll reset valid valid nop t ch t ih t is t cl tc1 td0 te1 td1 t cksre t ch b t cl b t ck b t ch b t cl b t ck b t ch b t cl b t ck b t cpded odt nop te0 previous clock frequency new clock fre quency frequency change indicates a break in time scale t ih t is t ih t is t dllk t aofpd/ t aof t cksrx high-z high-z 127(6 1. $ssolfdeohiruerwkvorzh[lwdqgidvwh[lwsuhfkdujhsrzhugrzqprghv 2. t $2)3' dqg t $2) pxvw eh vdwlvilhg dqg rxwsxwv +ljk= sulru wr 7 vhh v2q'lh 7huplqdwlrq 2'7 wrqsdjhiruh[dfwuhtxluhphqwv  3. ,iwkh5 tt b120ihdwxuhzdvhqdeohglqwkhprghuhjlvwhusulruwrhqwhulqjsuhfkdujhsrzhugrzq prgh wkh 2'7 vljqdo pxvw eh frqwlqxrxvo\ uhjlvwhuhg /2: hqvxul qj 5 tt  lv lq dq rii vwdwh ,i the r tt b120ihdwxuhzdvglvdeohglqwkhprghuhjlvwhusulruwrhqwhulqjsuhfkdujhsrzhugrzq prgh5 tt zloouhpdlqlqwkhriivwdwh7kh2'7vljqdofdqehuhjlvwhuhg hlwkhu/2:ru+,*+lq wklvfdvh
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product )ruehwwhuvljqdolqwhjulw\''56'5$0phpru\vxev\vwhpghvlj qvkdyhdgrswhgxvhriio\e\wrsrorj\iruwkhfrppdqgvdgguhv vhvfrqwurovljqdovdqg forfnv:5,7(ohyholqjlvdvfkhphiruwkhphpru\frqwuroohuw rghvnhzwkh'46[vwureh '46['46[? wr&.uhodwlrqvklsdww kh6'5$0zlwkdvlpsoh ihhgedfnihdwxuhsurylghglwe\wkh''56'5$0lwvhoi:5,7(ohyholqjlvjhqhudoo\xvhgdvsduwriwkhlqlwldol]dwlrqsurfhvv liuhtxluhg)ru1250$/ 6'5$0rshudwlrqwklvihdwxuhpxvwehglvdeohg7klvlvwkhrqo\6'5$0rshudwlrqzkhuhwkh'46ixqfwlrqvdvdqlqsxw wrfdswxuhwkhlqfrplqjforfn dqg wkh'4vixqfwlrqdvrxwsxwv wruhsruwwkhvwdwriwkhforfn 1rwhwkdwqrqvwdqgdug2'7vfkhphvduhuhtxluhg 7khphpru\frqwuroohuxvlqjwkh:5,7(ohyholqjsurfhgxuhpxvwkdyhdgmxvwdeohghod\vhwwlqjrqlwv'46vwurehwrdoljqwkhulvlqjhgjhri'46wrwkhforfn dwwkh6'5$0slqv7klvlvdffrpsolvkhgzkhqwkh6'5$0dv\qfku rqrxvo\ihhgvedfnwkh&.vwdwxvyldwkh'4exvdqgvdpsohvzlw kwkhulvlqjhgjhri '467khfrqwuroohuuhshdwhgo\ghod\vwkh'46vwurehxqwlod& .wudqvlwlrqiurpvwwrvwlvghwhfwhg7kh'46ghod\hvwdeo lvkhgwkurxjkwklvsurfhgxuh helps ensure t dqss, t dss, and t '6+vshflilfdwlrqvlqv\vwhpvwkdwxvhio\e\wrsrorj\e\ghvnhzlqjwkhwudfhohqjwkplvpdwfk$frqfhswxdowlplqjriwklv surfhgxuhlvvkrzqlq)ljxuh write leveling f igure 38- w rite l eveling c oncept ck ck# source differential dqs differential dqs differential dqs dq dq ck ck# destination destination push dqs to capture 0C1 transition t0 t1 t2 t3 t4 t5 t6 t7 t0 t1 t2 t3 t4 t5 t6 tn ck ck# t0 t1 t2 t3 t4 t5 t6 tn dont care 1 1 0 0
logic devices incorporated www.logicdevices.com 80 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product :khq:5,7(ohyholqjlvhqdeohgwkhulvlqjhgjhri'46vdpsohv&.dqgwkhulph'4rxwsxwvwkhvdpsohg&.uvvwdwxv7khsulph'4iruhdfkriwkh  zrugvfrqwdlqhglqwkhl02'lv'4iruwkhorze\wh'4ir uwkhkljke\wh,wrxwsxwvwkhvwdwxvri&.vdpsohge\/'46[ dqg8'46[$oorwkhu'4v '4>@'4>@iruwkhorzzrug'4>@'4>@iruwkhqh[wzrug'4>@'4>@iruwkhqh[wdqg'4>@'4>@iruwkh+,*+zrug  frqwlqxhwrgulyh/2:7zrsulph'4rqhdfkriwkh  zrugvf rqwdlqhglqwkh/',l02'doorzhdfke\whodqhwrehohyhohglqghshqghqwo\ write leveling $phpru\frqwuroohulqlwldwhvwkh6'5$0:5,7(/hyholqjprghe\vhwwlqjwkh05>@wrdvwdvvxplqjwkhrwkhusurjudppdeohih dwxuhv 050505 dqg05 duhiluvwvhwdqgwkh'//lvixoo\uhvhwdqgorfnhg7kh'4edoovhqwhuwkh:5,7(/hyholqjprghjrlqjiurpdv+,*+=wvwdwhwrdqxqghilqhgguly - lqjvwdwhvrwkh'4exvvkrxogqrwehgulyhq'xulqj:5,7(/hyholqjprghrqo\wkh123dqg'(6frppdqgvduhdoorzhg7khphpru\frqwuroohuvkrxog dwwhpswwrohyhorqo\rqhudqndwdwlphwkxvwkhrxwsxwvrirwkhuudqnvvkrxogehglvdeohge\vhwwlqj05>@wrdvw7khphpru\frqwuroohupd\dvvhuw 2'7diwhud t 02'ghod\dvwkh6'5$0zlooehuhdg\wrsurfhvvwkh2'7/rqgho d\ :/ t &. surylghglwgrhvqrwylrodwhwkhdiruhphqwlrqhg t mod delay uhtxluhphqw 7khphpru\frqwuroohupd\gulyh/'46[8'46[/2:dqg/'46[?8' 46[?+,*+diwhu t :/'46(1kdvehhqvdwlvilhg7khfrqwuroohupd\ehjlqwrwrjjoh /'46[8'46[diwhu t :/05' rqh/>8@'46vwrjjohlv'46vwudqvlwlrqlqjiurpd/2:vwd whwrd+,*+vwdwhzlwk/>8@'46[?wudqvlwlrqlqjiurpd+,*+vwd wh wrd/2:vwdwhwkhqerwkwudqvlwlrqedfnwrwkhluruljlqdovwd whv $wdplqlpxp2'7/rqdqg t $21pxvwehvdwlvilhgdwohdvwrqhforfnsulruwr'46wrjjolqj $iwhu t :/05'dqg'46/2:suhdpeoh t :35( kdyhehhqvdwlvilhgwkhphpru\frqwuroohupd\surylghhlwkhudvlqjoh'46[wrjjohrupxowlsoh'46[wrjjohv wrvdpsoh&.irudjlyhq'46[wr&.vnhz(dfk'46wrjjohpxvw qrwylrodwh t '46/ 0,1 dqg t '46+ 0,1 vshflilfdwlrqv t '46/ 0$; dqg t '46+ 0$;  vshflilfdwlrqvduhqrwdssolfdeohgxulqj:5,7(ohyholqjprgh7kh'46[pxvwehdeohwrglvwlqjxlvkwkh&.uvulvlqjhgjhzlwkl q t :/6dqg t :/+7khsulph '4zloorxwsxwwkh&.uvvwdwxvdv\qfkurqrxvo\iurpwkhdvvrfldwhg'46[ulvlqjhgjh&.fdswxuhzlwklq t :/27khuhpdlqlqj'4vwkdwdozd\vgulyh/2: zkhq'46lvwrjjolqjpxvweh/2:zlwklq t :/2(diwhuwkhiluvw t :/2lvvdwlvilhg wkhsulph'4vjrlqj/2: $vsuhylrxvo\qrwh g'46[lvdqlqsxwdqgqrw dqrxwsxwgxulqjwklvsurfhvv)ljxuhghslfwvwkhedvlfwlplqjsdudphwhuviruwkhryhudoozulwhohyholqjsurfhgxuh 7khphpru\frqwuroohuzlooolnho\vdpsohhdfkdssolfdeohsulph'4vwdwhdqgghwhuplqhzkhwkhuwrlqfuhphqwrughfuhphqwlw'46 ghod\vhwwlqj$iwhuwkh phpru\frqwuroohushuirupvhqrxjk'46[wrjjohvwrghwhfwwkh&.uvvwwudqvlwlrqwkhphpru\frqwuroohuvkrxogorfnwkh'46ghod\vhwwlqjiruwkh6'5$0 l02'ghylfh$iwhuorfnlqjwkh'46vhwwlqjohyholqjiruwkhudqnzlookdyhehhqdfklhyhgdqgwkh:5,7(ohyholqjprghiruwkhudqnvkrxogehglvdeohgru uhsurjudpphg li:5,7(ohyholqjridqrwkhuudqniroorzv  write leveling procedure
logic devices incorporated www.logicdevices.com 81 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 39- w rite l eveling s equence ck ck# command t1 t2 early remaining dq late remaining dq t wloe nop 2 nop mrs 1 nop nop t wls t wlh dont care undefined driving mode indicates a break in time scale prime dq 5 differential dqs 4 odt t mod t dqsl 3 t dqs h 3 t dqsh 3 t wlo t wlmrd t wldqsen t wlo t wlo t wlo t dqsl 3 nop nop nop nop nop nop nop 127(6 1. 056/rdg05wrhqwhuzulwhohyholqjprgh 2. 123123ru'(6 3. '46'46qhhgvwrixoilooplqlpxpsxovhzlgwkuhtxluhphqwv t '46+ 0,1 dqg t '46/ 0,1 dv ghilqhgiruuhjxoduzulwhv7khpd[lpxpsxovhzlgwklvv\vwhpghshqghqw 4. 'liihuhqwldo'46lvwkhgliihuhqwldogdwdvwureh '46'46 7 lplqjuhihuhqfhsrlqwvduhwkh]hur furvvlqjv7khvrolgolqhuhsuhvhqwv'46wkhgrwwhgolqhuhsuhvhqwv'46 5. '5$0gulyhvohyholqjihhgedfnrqdsulph'4 '4iru[dqg[ 7khuhpdlqlqj'4duhgulyhq /2:dqguhpdlqlqwklvvwdwhwkurxjkrxwwkhohyholqjsurfhgxuh $iwhuwkh''56'5$0l02'kdvehhq:5,7(ohyhohgwkhfrqwuroohupxvwh[lwiurp:5,7(/hyholqjprghehiruhwkh1250$/prghfdq ehxvhg)ljxuh ghslfwvdjhqhudosurfhgxuhlqh[lwlqj:5,7(/hyholqj$iwh uwkhodvwulvlqj'46 fdswxulqjdvwdw7 wkhphpru\frqwu roohuvkrxogvwrsgulylqjwkh'46 vljqdovdiwhu t :/2 0$; ghod\soxvhqrxjkghod\wrhqdeohwkhphpru\frqwuroohuwrfdswxuhwkhdssolfdeohsulph'4vwdwh dwy7e 7kh'4edoovehfrph xqghilqhgzkhq'46qrorqjhuuhpdlqv/2:dqgwkh\uhpdlqxqghilqhgxqwlo t 02'diwhuwkh056frppdqg dw7h  7kh2'7lqsxwvkrxogehghdvvhuwhg/2:vxfkwkdw2'7/rii 0,1 h[sluhvdiwhuwkh'46[lvqrorqjhugulylqj/2::khq2'7/2:vdwlvilhv t is, odt pxvwehnhsw/2: dwy7e xqwlowkh6'5$0lvuhdg\iruhlwkhudqrwkhuudqnwrehohyhohgruxqwlowkh1250$/prghfdqehxvhg $iwhu'46whuplqdwlrqlv vzlwfkhgrii:5,7(ohyhoprghvkrxogehglvdeohgyldwkh056frppdqg dw t $  $iwhu t 02'lvvdwlvilhg dw7h dq\ydolgfrppdqgpd\ehuhjlvwhuhg e\wkh6'5$06rph056frppdqgvpd\ehlvvxhgdiwhu t 05' dw7g  write leveling exit mode
logic devices incorporated www.logicdevices.com 82 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 40- e xit w rite l eveling notes: 1. the dq result, = 1, between ta0 and tc0, is a result of the dqs, dqs# signals capturing ck high just after the t0 state. nop ck t0 t1 t2 ta0 tb0 tc0 tc1 tc2 td0 td1 te0 te1 ck# command odt r tt _dq nop r mponponponpon pon s nop nop add ress mr1 valid valid valid valid don t care transitioning r tt dqs, r tt dqs r # tt _ nom undefined driving mode t aof (max) t mrd indicates a break in time scale dqs, dqs# ck = 1 dq t is t aof (min) t mod t wlo + t wloe odtl off
logic devices incorporated www.logicdevices.com 83 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product initialization 7khiroorzlqjvhtxhqfhlvuhtxluhgirusrzhuxsdqglqlwldol]dwlrqdvvkrzqlq)ljxuh 1. $sso\srzhu5(6(7?lvuhfrpphqghgwrehehorz[9 dd 4gxulqjsrzhuudpswrhqvxuhwkhrxwsxwvuhpdlqglvdeohg +,*+= dqg 2'7rii 5 tt lvdovr+,*+= $oorwkhulqsxwvlqfoxglqj2'7pd\ehxqghilqhg  'xulqjsrzhuxshlwkhuriwkhiroorzlqjfrqglwlrqvpd\h[lvw dqgpxvwehphw x condition a: x9 dd dqg9 dd 4duhgulyhqiurpdvlqjohsrzhuvrxufhdqgduhudpshgzlwkdp d[lpxpghowdyrowdjhehwzhhqwkhpri'9dp9 6orshuhyhuvdoridq\srzhuv xsso\vljqdolvdoorzhg7khyrow djhohyhovrqdooedoovrwkhuwkdq9 dd 9 dd 49vvdqg9vv4pxvweh ohvvwkdqruhtxdowr9 dd 4dqg9 dd rqrqhvlghdqgpxvwehjuhdwhuwkdqruhtxdowr9vv4dqg9vvrqwkhrwkhuvlgh x%rwk9 dd dqg9 dd 4srzhuvxssolhvudpswr9 dd  0,1 dqg9 dd 4 0,1 zlwklq t 9 dd 35 pv x%rwk9 dd dqg9 dd 4srzhuvxssolhvudpswr9 dd  0,1 dqg9 dd 4 0,1 zlwklq t 9 dd 35 pv x9 5()'4 wudfnv9 dd [9 5()&$ wudfnv9 dd x 0.5. x9 tt lvolplwhgwr9zkhqwkhsrzhuudpslvfrpsohwhdqglvqrwdssolhggluhfwo\wrwkhghylfhkrzhyhu t 97'vkrxogeh juhdwhuwkdqruhtxdowr]hurwrdyrlgghylfhodwfkxs x&rqglwlrq% x9 dd pd\ehdssolhgehiruhrudwwkhvdphwlphdv9 dd q. x9 dd 4pd\ehdssolhgehiruhrudwwkhvdphwlphdv9 tt 9 5()'4 dqg9 5()&$ . x1rvorshuhyhuvdovduhdoorzhglqwkhsrzhuvxsso\udpsiruwklvfrqglwlrq 2. 8qwlovwdeohsrzhupdlqwdlq5(6(7?/2:wrhqvxuhwkhrxwsxwvu hpdlqglvdeohg +,*+= $iwhuwkhsrzhulvvwdeoh5(6(7?pxvweh /2:irudwohdvw?vwrehjlqwkhlqlwldol]dwlrqsurfhvv2'7zloouhpdlqlqwkh+,*+=vwdwhzkloh5(6(7?lv/2:dqgxqwlo &.(lv uhjlvwhuhg+,*+ 3. &.(pxvweh/2:qvsulruwr5(6(7?wudqvlwlrqlqj+,*+ 4. $iwhu5(6(7?wudqvlwlrqv+,*+zdlw?v plqxvrqhforfn zlwk&.(/2: 5. $iwhuwklv&.(/2:wlph&.(pd\eheurxjkw+,*+ v\qfkurqrxvo\ dqgrqo\123ru'(6frppdqgvpd\ehlvvxhg7khforfnpxvweh suhvhqwdqgydolgirudwohdvwqv dqgdplqlpxpriilyhforfnv dqg2'7pxvwehgulyhq/2:dwohdvww,6sulruwr&.(ehlqjuhjlvwhuhg +,*+:khq&.(lvuhjlvwhuhg+,*+lwpxvwehfrqwlqxrxvo\uhjlvwhuhg+,*+xqwlowkhixoolqlwldol]dwlrqsurfhvvlvfrpsohwh 6. $iwhu&.(lvuhjlvwhuhg+,*+dqgdiwhu t ;35kdvehhqvdwlvilhg056frppdqgvpd\ehlvvxhg,vvxhdq056 /2$'02'( frppdqg wr05zlwkwkhdssolfdeohvhwwlqjv surylgh/2:wr%$dqg%$dqg+,*+wr%$   ,vvxhdq056frppdqgwr05zlwkwkhdssolfdeohvhwwlqjv 8. ,vvxhdq056frppdqgwr05zlwkwkhdssolfdeohvhwwlqjvlqfoxglqjhqdeolqjwkh'//dqgfrqiljxulqj2'7 9. ,vvxhdqg056frppdqgwr05zlwkwkhdssolfdeohvhwwlqjvlqfoxglqjd'//5(6(7frppdqg t '//.  f\fohvriforfnlqsxwduh uhtxluhgwrorfnwkh'// 10. ,vvxhd=4&/frppdqgwrfdoleudwh5 tt dqg521ydoxhviruwkhsurfhvvyrowdjhwhpshudwxuh 397 3ulruwr1250$/rshudwlrq t =4,1,7 pxvwehvdwlvilhg 11. :khq t dllk and t =4,1,7kdyhehhqvdwlvilhgwkh''56'5$0zlooehuhdg\iruqrupdorshudwlrq operations
logic devices incorporated www.logicdevices.com 84 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 41- i nitialization s equence ck e r tt ba[2:0] all voltage supplies valid and stable t = 200s (min) dm dqs add ress a10 ck ck# t cl command nop t0 ta0 don t care t cl t is t ck odt dq tb 0 t dllk mr1 with dll ena ble mr0 with dll reset t mrd t mod mrs mrs ba0 = h ba1 = l ba2 = l ba0 = l ba1 = l ba2 = l code code code code valid valid valid valid normal operation mr2 mr3 t mrd t mrd mrs mrs ba0 = l ba1 = h ba2 = l ba0 = h ba1 = h ba2 = l code code code code tc0 td 0 v tt v ref v dd q v dd reset# t = 500s (min) t ck s r x sta ble and vali d clo ck valid power-up ramp t (max) = 200ms dram ready for external commands t1 t zq init zq cali bration a10 = h zqcl t is see power-up c onditions in the initialization sequence text, set up 1 t xpr valid = 20ns t io z indicates a break in time scale t (min) = 10ns t vtd
logic devices incorporated www.logicdevices.com 85 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 0rghuhjlvwhuv 0505 duhxvhgwrghilqhydulrxvprghvrisurjudppdeohrshudwlrqriwkh''56'5$0l02'$prghuhjlvwhulvsurjudpphgyld wkh02'(5(*,67(56(7 056 frppdqggxulqjlqlwldol]dwlrqdqglwuhwdlqvwkhvwruhglqirupdwl rq h[fhswiru05>@zklfklvvh oifohdulqj xqwlolwlvhlwkhu uhsurjudpphg5(6(7?jrhv/2:ruxqwlowkhghylfhorvhvsrzhu &rqwhqwvridprghuhjlvwhufdqehdowhuhge\uhh[hfxwlqjwkh056frppdqg,iwkhxvhufkrrvhvwrprgli\rqo\dvxevhwriwkhprghuhjlvwhuuvyduldeohv dooyduldeohvpxvwehsurjudpphgzkhqwkh056frppdqglvlvvxhg5hsurjudpplqjwkhprghuhjlvwhuzlooqrwdowhuwkhfrqwhqwvriwkhphpru\duud\ surylghglwlvshuiruphgfruuhfwo\ 7kh056frppdqgfdqrqo\ehlvvxhg ruuhlvvxhg zkhqdooedqnvduhlgohdqglqwkh35(&+$5*('vwdwh t 53lvvdwlvilhgdqgqrgdwdexuvwvduhlqsurj - uhvv $iwhudq056frppdqgkdvehhqlvvxhgwzrsdudphwhuvpxvwehvdwlvilhg t mrd and t mod. 7khfrqwuroohupxvwzdlw t 05'ehiruhlqlwldwlqjdq\vxevhtxhqw056frppdqgv vhh)ljxuh  mode registers f igure 42- mrs- to -mrs c ommand t iming ( t mrd) valid valid mrs 1 mrs 2 nop nop nop nop t0 t1 t2 ta0 ta1 ta2 ck# ck command add ress cke 3 don t care indicates a break in time scale t mrd 127(6 1. 3ulruwrlvvxlqjwkh056frppdqgdooedqnvpxvwehlgohdqgsuhfkdujhg t 53 0,1 pxvwehvdwlvilhg dqgqrgdwdexuvwvfdqehlqsurjuhvvwkhohyholqjsurfhgxuh 2. t 05'vshflilhvwkh056wr056frppdqgplqlpxpf\fohwlph 3. &.( pxvw eh uhjlvwhuhg +,*+ iurp wkh 056 frppdqg xqwlo t 0563'(1 0,1  vhh v3rzhu'rzq 0rghwrqsdjh  4. )rud&$6odwhqf\fkdqjh t ;3'//wlplqjpxvwehphwehiruhdq\qrq056frppdqg 7khfrqwuroohupxvwdovrzdlw t 02'ehiruhlqlwldwlqjdq\qrq056frppdqgv h[foxglqj123dqg'(6 dvvkrzqlq)ljxuhrqsdjh7kh'5$0 uhtxluhv t 02'lqrughuwrxsgdwhwkhuhtxhvwhgihdwxuhvzlwkwkhh[fhswlrqri'//5(6(7zklfkuhtxluhvdgglwlrqdowlph8qwlo t 02'kdvehhqvdwlvilhgwkh xsgdwhgihdwxuhvduhwrehdvvxphgxqdydlodeoh
logic devices incorporated www.logicdevices.com 86 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 43- mrs- to - non mrs c ommand t iming ( t mod) ck ck# command t1 t2 early remaining dq late remaining dq t wloe nop 2 nop mrs 1 nop nop t wls t wlh dont care undefined driving mode indicates a break in time scale prime dq 5 differential dqs 4 odt t mod t dqsl 3 t dqs h 3 t dqsh 3 t wlo t wlmrd t wldqsen t wlo t wlo t wlo t dqsl 3 nop nop nop nop nop nop nop 127(6 1. 3ulruwrlvvxlqjwkh056frppdqgdooedqnvpxvwehlgoh wkh\pxvwehsuhfkdujhg t 53pxvweh vdwlvilhgdqgqrgdwdexuvwvfdqehlqsurjuhvv  2. 3ulruwr7dzkhq t 02' 0,1 lvehlqjvdwlvilhgqrfrppdqgv h[fhsw123'(6 pd\ ehlvvxhg 3. ,i577zdvsuhylrxvo\hqdeohg2'7pxvwehuhjlvwhuhg/2:dw7 vrwkdw2'7/lvvdwlvilhgsulru wr7d2'7pxvwdovrehuhjlvwhuhg/2:dwhdfkulvlqj&.hgjhiurp7xqwlo t 02' 0,1 lv vdwlvilhgdw7d 4. &.( pxvw eh uhjlvwhuhg +,*+ iurp wkh 056 frppdqg xqwlo t 0563'(1 0,1  dw zklfk wlph srzhugrzqpd\rffxu vhhv3rzhu'rzq0rghwrqsdjh  mode register 0 (mr0) 7khedvhuhjlvwhu05lvxvhgwrghilqhydulrxv''5l02'prghvrirshudwlrq7khvhghilqlwlrqvlqfoxghwkhvhohfwlrqride xuvwohqjwkexuvww\sh&$6 odwhqf\rshudwlqjprgh'//5(6(7:5,7(uhfryhu\dqg35(&+$5*(srzhugrzqprghdvvkrzqlq)ljxuh
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product mode register 0 (mr0) $ffhvvhvzlwklqdjlyhqexuvwpd\ehsurjudpphgwrhlwkhudvhtxhqwldo rudqlqwhuohdyhgrughu7khexuvww\shlvvhohfwhgyld05>@dvvkrzq lq)ljxuh7khrughulqjridffhvvhvzlwklqdexuvwlvghwhuplqhge\wkh exuvw ohqjwk wkh exuvw w\sh dqg wkh vwduwlqj froxpq dgguhvv dv vkrzq lq7deoh''5rqo\vxssruwvelwexuvwfkrsdqgelwexu vwdffhvv prghv )xoo lqwhuohdyhgdgguhvv rughulqj lvvxssruwhg iru5($'vzkloh :5,7(vduhuhvwulfwhgwrqleeoh %& ruzrug %/ erxqgdulhv burst type burst length %xuvw ohqjwk lv ghilqhg e\ 05>@ vhh )ljxuh    5($' dqg :5,7( dffhvvhv wr wkh ''5 6'5$0 l02' duh exuvwrulhqwhg zlwk wkh ex uvw ohqjwkehlqjsurjudppdeohwrvw fkrsprgh vw il[hgexuvw ruvhohfw - deoh xvlqj $ gxulqj d 5($':5,7( frppdqg rq wkh io\   7kh e xuvw ohqjwk ghwhuplqhv wkh pd[lpxp qxpehu ri froxpq orfdwlrqv wkdw f dq eh dffhvvhgirudjlyhq5($'ru:5,7(frppdqg:khq05>@lvvhwwr vwgxulqjd5($':5,7(frppdqgli$ wkhq%& fkrs prg hlv vhohfwhg,i$ wkhq%/prghlvvhohfwhg6shflilfwlplqjgldjudpv dqg wxuqdurxqg ehwzhhq 5($':5,7( duh vkrzq lq wkh 5($':5,7( vhfwlrqvriwklvgrfxphqw :khq d 5($' ru :5,7( frppdqg lv lvvxhg d eorfn ri froxpqv htxd o wrwkhexuvwohqjwklvhiihfwlyho\vhohfwhg$oodffhvvhviru wkdwexuvwwdnh sodfhzlwklqwklveorfnphdqlqjwkdwwkhexuvwzloozudszlwklqwkheorfnli derxqgdu\lvuhdfkhg7kheorfnlvxqltxho\vhohfwhge\$>l@zkhqwkh exuvw ohqjwk lv vhw wr vw dqg e\ $>l@ zkhq wkh exuvw ohqjwk lv vhw wr vw zkhuh$llvwkhprvwvljqlilfdqwfroxpqdgguhvvelwirudjlyhqvwduwlqjorfd - wlrqzlwklqwkheorfn7khsurjudpphgexuvwohqjwkdssolhvwrerwk5($' dqg:5,7(exuvwv f igure 44- m ode r egister 0 (mr0) d efinitions notes: 1. mr0[16, 13, 7, 2] are reserved for future use and must be programmed to 0. 0 1 bl cas# latency bt pd a9 a7 a6 a5 a4 a3 a8 a2 a1 a0 mode register 0 (mr0) address bus 9765432 810 a10 a12 a11 1a b0 ab 3 12 11 10 1 m3 0 1 read burst type sequential (nibble) interleaved cas latency reserved 5 6 7 8 9 10 11 m4 0 1 0 1 0 1 0 1 m5 0 0 1 1 0 0 1 1 m6 0 0 0 0 1 1 1 1 15 dll write recovery reserved 5 6 7 8 10 12 reserved wr 0 0 m12 0 1 precharge pd dll off (slow exit) dll on (fast exit) ba2 16 0 1 burst length fixed bl8 4 or 8 (on-the-fly via a12) fixed bc4 (chop) reserved m0 0 1 0 1 m1 0 0 1 1 m9 0 1 0 1 0 1 0 1 m10 0 0 1 1 0 0 1 1 m11 0 0 0 0 1 1 1 1 m14 0 1 0 1 m15 0 0 1 1 mode register mode register 0 (mr0) mode register 1 (mr1) mode register 2 (mr2) mode register 3 (mr3) a13 14 0 1 0 1 m8 0 1 dll reset no yes
logic devices incorporated www.logicdevices.com 88 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product burst length read/write address (a[2,1,0]) type = sequential type = interleaved &+23 8 ==== ==== ==== ==== ==== ==== ==== ==== ;;;; ;;;;          t able 60: b urst o rder notes 1,2 1,2 1,2 1,2 1,2 1,2 1,2 1,2 1,3,4 1,3,4 1 1 1 1 1 1 1 1 1,3 burst type (decimal) ==== ==== ==== ==== ==== ==== ==== ==== ;;;; ;;;;          0 0 0 0 0 1 0 1 0 0 1 1 1 0 0 1 0 1 1 1 0 1 1 1 99 99 0 0 0 0 0 1 0 1 0 0 1 1 1 0 0 1 0 1 1 1 0 1 1 1 999 5($' :5,7( 5($' :5,7( starting column 2. = 'dwddqg6wurehrxwsxwgulyhuvlqwulvwdwh 3. ; w'rquw&duhw 127(6 1. ,qwhuqdo5($'dqg:5,7(rshudwlrqvvwduwdwwkhvdphsrlqwlqw lphiru %&dvwkh\griru%/ '//5(6(7lvghilqhge\05>@ vhh)ljxuh 3urjudpplqj05 >@ wrvwdfwlydwhvwkh'//5(6(7ixqfwlrq05>@lvvhoifohdulqjphdq - lqj lw uhwxuqv wr d ydoxh ri vw diwhu wkh '// 5(6(7 ixqfwlrq k dv ehhq initiated. $q\wlphwkh'//5(6(7ixqfwlrqkdvehhqlqlwldwhg&.(pxvweh +,*+ dqg wkh forfn khog vwdeoh iru  t '//.  forfn f\fohv ehiruh d 5($' frppdqgfdqehlvvxhg7klvlvwrdoorzwlphiruwkhlqwhuqdoforfnwreh v\qfkurql]hgzlwkwkhh[whuqdoforfn)dlolqjwrzdlwiruv\qfkurql]dwlrq wrrffxupd\uhvxowlqlqydolgrxwsxwwlplqjvshflilfdwlrqvvxfkdv t '46&. wlplqjv dll reset :5,7(5(&29(5<wlphlvghilqhge\05>@ vhh)ljxuh : 5,7( 5(&29(5< ydoxhv ri  ru  pd\ eh xvhg e\ surjudpplqj 05>@7khxvhulvuhtxluhgwrsurjudpwkhfruuhfwydoxhr i:5,7( 5(&29(5<dqglvfdofxodwhge\glylglqj t :5 qv e\ t &. qv dqgurxqg - lqj xs d qrqlqwhjhu ydoxh wr wkh qh[w lqwhjhu :5 f\fohv urx qgxs t :5>qv@ t &.>qv@  write recovery
logic devices incorporated www.logicdevices.com 89 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 7kh35(&+$5*(3'elwdssolhvrqo\zkhq35(&+$5*(srzhugrzq prghlvehlqjxvhg:khq05>@lvvhwwrvwwkh'//lvriigxulqj 35(&+$5*(srzhugrzqsurylglqjdorzhuvwdqge\fxuuhqwprghkr z- ever, t ;3'// pxvw eh vdwlvilhg zkhq h[lwlqj  :khq 05>@ lv vhw wr vwwkh'//frqwlqxhvwruxqgxulqj35(&+$5*(srzhugrzqprgh wr hqdeoh d idvwhu h[lw ri 35(&+$5*( srzhugrzq prgh krzhyhu t ;3 pxvwehvdwlvilhgzkhqh[lwlqj vhh3rzhu'rzqprghrq3djh  precharge power-down (precharge pd) 7kh&/lvghilqhge\05>@dvvkrzqlq)ljxuh&$6odwh qf\lvwkh ghod\dvphdvxuhglqforfnf\fohvehwzhhqwkhlqwhuqdo5($'frppdqg dqgwkhdydlodelolw\riwkhiluvwelwriydolgrxwsxwgdwd7kh&/fdqehvhw wrru''56'5$0l02'vgrqrwvxssruwkdoiforfnodwhqflhv ([dpsohvri&/ dqg&/ duhvkrzqlq)ljxuh ehorz ,idqlqwhuqdo 5($'frppdqglvuhjlvwhuhgdwforfnhgjhqdqgwkh&$6odwhqf\ lvp forfnvwkhgdwdzlooehdydlodeohqrplqdoo\frlqflghqwzlwkforfnhgjhqp  7deohlqglfdwhvwkh&/vvxssruwhgdwdydlodeohrshudwlqjiuhtxhqflhv cas latency (cl) f igure 45- read l atency read nop nop nop nop nop nop nop ck ck# command dq dqs, dqs# dqs, dqs# t0 t1 t2 t3 t4 t5 t6 t7 t8 dont care ck ck# command dq read nop nop nop nop nop nop nop t0 t1 t2 t3 t4 t5 t6 t7 t8 di n + 3 di n+ 1 di n + 2 di n + 4 di n di n nop nop al = 0, cl = 8 al = 0, cl = 6 transitioning data 127(6 1. )rulooxvwudwlrqsxusrvhvrqo\&/ dqg&/ duhvkrzq2w khu&/ydoxhvduh srvvleoh 2. 6krzqzlwkqrplqdo t '46&.dqgqrplqdo t dsdq.
logic devices incorporated www.logicdevices.com 90 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 7kh 02'( 5(*,67(5  05  frqwurov dgglwlrqdo ixqfwlrqv dqg ihd wxuhv qrw dydlodeoh lq wkh rwkhu prgh uhjlvwhuv 4 2)) 287387 ',6$%/(  '// (1$%/('//',6$%/(5 tt b120ydoxh 2'7 :5,7(/(9(/,1*3267('&$6$'',7,9(odwhqf\dqg287387'5,9(675(1*7+7khvhixqfwlrqv duhfrqwuroohgyldwkhelwvvkrzqlq)ljxuhehorz7kh05uhjlvwhulvsurjudpphgyldwkh05frppdqgdqguhwdlqvwkhvwruhglqirupdwlrqxqwlolwlv uhsurjudpphgxqwlo5(6(7?jrhv/2: wuxh ruxqwlowkhghylfhorvhvsrzhu5hsurjudpplqjwkh05uhjlvwhuzlooqrwdowhuwk hfrqwhqwvriwkhphpru\ duud\surylghgwkhrshudwlrqlvshuiruphgfruuhfwo\ 7kh05uhjlvwhupxvwehordghgzkhqdooedqnvduhlgohdqgqrexuvwvduhlqsurjuhvv7khfrqwuroohupxvwvdwlvi\wkhvshflilhgwlplqjsdudphwhuv t mrd and t 02'ehiruhlqlwldwlqjdvxevhtxhqwrshudwlrq mode register 1 (mr1) f igure 46- m ode r egister 1 (mr1) d efinition al r tt q off a9 a7 a6 a5 a4 a3 2a 8 aa1 a0 mode register 1 (mr1) address bus 9 7 6 5 4 3 2 810 a10 a12 a11 1ab 0ab 31 21 11 01 m0 0 1 dll enable enable (normal) disable m5 0 0 1 1 output drive strength rzq/6 (40 [nom]) rzq/7 (34 [nom]) reserved reserved 14 wl 1 sdo 0 dll r tt tdqs m12 0 1 q off enabled disabled ba2 15 0 1 m7 0 1 write levelization disable (normal) enable additive latency (al) disabled (al = 0) al = cl - 1 al = cl - 2 reserved m3 0 1 0 1 m4 0 0 1 1 r tt ods m1 0 1 0 1 a13 16 0 1 m11 0 1 tdqs disabled enabled 0 1 0 1 r tt _ nom (odt) 2 non-writes r tt _ nom disabled rzq/4 (60 [nom]) rzq/2 (120 [nom]) rzq/6 (40 [nom]) rzq/12 (20 [nom]) rzq/8 (30 [nom]) reserved reserved r tt _ nom (odt) 3 writes r tt _ nom disabled rzq/4 (60 [nom]) rzq/2 (120 [nom]) rzq/6 (40 [nom]) n/a n/a reserved reserved m2 0 1 0 1 0 1 0 1 m6 0 0 1 1 0 0 1 1 m9 0 0 0 0 1 1 1 1 mode register mode register set 0 (mr0) mode register set 1 (mr1) mode register set 2 (mr2) mode register set 3 (mr3) m14 0 1 0 1 m15 0 0 1 1 127(6 1. 05>@duhuhvhuyhgiruixwxuhxvhdqgpxvwehsurjudpphgwrvw 2. 'xulqjzulwhohyholqjli05>@dqg05>@duhvwwkhqdoo5 tt b120ydoxhvduhdydlodeoh iruxvh 3. 'xulqjzulwhohyholqjli05>@lvdvwexw05>@lvdvwwkhqrqo\5 tt b120zulwhydoxhv duhdydlodeohiruxvh
logic devices incorporated www.logicdevices.com 91 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 7kh'//pd\ehhqdeohgruglvdeohge\surjudpplqj05>@gxulqj wkh /2$' 02'( frppdqg dv vkrzq lq )ljxuh  suhylrxv sdjh   7kh '//pxvwehhqdeohgiru1250$/rshudwlrq'//(1$%/(lvuhtxlu hg gxulqjsrzhuxslqlwldol]dwlrqdqgxsrquhwxuqlqjwr1250$/rshudwlrq diwhukdylqj',6$%/('wkh'//iruwkhsxusrvhrighexjjlqjruh ydoxd - wlrq(1$%/,1*wkh'//vkrxogdozd\vehiroorzhge\uhvhwwlqjwkh'// xvlqjwkhdssursuldwh/2$'02'(frppdqg ,iwkh'//lvhqdeohgsulruwrhqwhulqj6(/)5()5(6+prghwkh'//lv dxwrpdwlfdoo\',6$%/('zkhqhqwhulqj6(/)5()5(6+rshudwlrqdqg  lvdxwrpdwlfdoo\5((1$%/('dqg5(6(7xsrqh[lwri6(/)5()5(6+   ,i wkh '// lv ',6$%/(' sulru wr hqwhulqj 6(/) 5()5(6+ wkh '// uhpdlqv',6$%/('hyhqxsrqh[lwriwkh6(/)5()5(6+rshudwlrqxqwlo lwkdvehhq5((1$%/('dqg5(6(7 7kh6'5$0lvqrwwhvwhgqrugrhv/',zduudqwfrpsoldqfhzlwk1 250$/ prghwlplqjvruixqfwlrqdolw\zkhqwkh'//lvglvdeohg$qdwwhpswkdv ehhqpdghiruwkh6'5$0wrrshudwhlqwkh1250$/prghzkhqhyhu srvvleohzkhqwkh'//lvglvdeohgkrzhyhue\lqgxvwu\vwdqgdu gvwkh iroorzlqjh[fhswlrqvkdyhehhqrevhuyhgghilqhgdqgolvwhg 1. 2'7lv127$//2:('wrehxvhg 2. 7kh287387'$7$lvqrorqjhuhgjhdoljqhgwrwkhforfn 3. &/dqg&:/fdqrqo\ehvl[forfnv :khqwkh'//lv',6$%/('wlplqjdqgixqfwlrqdolw\fdqydu\iurpwkh 1250$/ rshudwlrqdo vshflilfdwlrqv zkhq wkh '// lv hqdeohg  ',6 - $%/,1*wkh'//dovrlpsolhvwkhqhhgwrfkdqjhwkhforfniuhtxhqf\ dll enable/dll disable 2'7uhvlvwdqfh5 tt b120lvghilqhge\05>@ vhh)ljxuh 7kh r tt  whuplqdwlrq ydoxh dssolhv wr wkh '4[ /'0[ 8'0[ />8@'46[ dqg  />8@'46[?7kh''5ghylfhdufklwhfwxuhvxssruwvpxowlsoh5 tt whuplqd - wlrqydoxhvedvhgrq5=4qzkhuhqfdqehrudqg5=4lv :. 8qolnh''5''52'7pxvwehwxuqhgriisulruwr5($',1*gdwd rxw dqgpxvwuhpdlqriigxulqj5($'exuvw5 tt b120whuplqdwlrqlvdoorzhg dq\wlphdiwhuwkh'5$0lvlqlwldol]hgfdoleudwhgdqgqrwshuiruplqj5($' dffhvvhv ru lq 6(/) 5()5(6+ prgh  $gglwlrqdoo\ :5,7( dffhvvh v zlwkg\qdplf2'7hqdeohg 5 tt b:5 whpsrudulo\uhsodfhv5 tt b120zlwk r tt b:5 7khdfwxdohiihfwlyhwhuplqdwlrq5 tt b())pd\ehgliihuhqwiurpwkh5 tt wdujhwhgydoxhgxhwrqrqolqhdulw\riwkhwhuplqdwlrq)ru5 tt b())ydoxhv dqgfdofxodwlrqvvhhwkh21',(7(50,1$7,21 2'7 ghvfulswlrq odwhu in this ds. 7kh 2'7 ihdwxuh lv ghvljqhg wr lpsuryh vljqdo lqwhjulw\ ri wkh phpru\ ghylfhe\hqdeolqjwkh''56'5$0frqwuroohuwrlqghshqghqwo\wxuq21 2))2'7irudq\rudooghylfhvlqwkhhqgghvljqvduud\7kh2'7lqsxw frqwuroslqlvxvhgwrghwhuplqhzkhq5 tt lvwxuqhgrq 2'7/rq dqgrii 2'7/rii dvvxplqj2'7kdvehhq(1$%/('yld05>@ 7lplqjviru2'7duhghwdlohglqwkhv21',(7huplqdwlrq 2'7 wghvfuls - tion later in this ds. on-die termination (odt) 7kh ''5 6'5$0 l02' xvhv d surjudppdeoh lpshgdqfh rxwsxw exiihu7khgulyhvwuhqjwkprghuhjlvwhuvhwwlqjlvghilqhge\ 05>@ 5=4  : >120@ lvwkhsulpdu\rxwsxwgulyhulpshgdqfhvhwwlqjiruwkh ghylfh7rfdoleudwhwkhrxwsxwgulyhulpshgdqfhdqgh[whuqdosuhflvlrq uhvlvwru 5=4 lvfrqqhfwhgehwzhhqwkh=4edoodqg9vv47kh ydoxhri the resistor is 240 :? 7khrxwsxwlpshgdqfhlvvhwgxulqjlqlwldol]dwlrq$gglwlrqdo lpshgdqfh fdoleudwlrqxsgdwhvgrqrwdiihfwghylfhrshudwlrqdqgdoogdwd vkhhwwlp - lqjvdqgfxuuhqwvshflilfdwlrqvduhphwgxulqjdqxsgdwh 7rphhwwkh : vshflilfdwlrqwkhrxwsxwgulyhvwuhqjwkpxvwehvhwwr 34: gxulqjlqlwldol]dwlrq7rrewdlqdfdoleudwhgrxwsxwgulyhulpshgdqfh diwhusrzhuxswkh''5l02'6'5$0qhhgvdfdoleudwlrqfrppdqg  wkdwlvsduwriwkhlqlwldol]dwlrqdqguhvhwsurfhgxuh output drive strength 7kh 287387 (1$%/( ixqfwlrq lv ghilqhg e\ 05>@ dv vkrzq lq )ljxuh:khqhqdeohg 05>@  doorxwsxwv '4['46[' 46[?  duhwulvwdwhg7khrxwsxw',6$%/(ihdwxuhlvlqwhqghgwrehx vhggxulqj i dd  fkdudfwhul]dwlrq ri wkh 5($' fxuuhqw dqg gxulqj t '466 pdujlqlqj :5,7(/(9(/,1* rqo\ output enable/disable 7kh:5,7(/(9(/,1*ixqfwlrqlvhqdeohge\05>@dvvkrzqlq) ljxuh :5,7(/(9(/,1*lvxvhg gxulqjlqlwldol]dwlrq wrghvnhzw kh'46[ vwureh wr forfn riivhw dv d uhvxow ri io\e\ wrsrorj\ ghvljqv  )ru ehwwhu vljqdo lqwhjulw\ vrph hqg xvh ghvljqv ri ''5 ghylfhv dgrswhg io\e\ wrsrorj\iruwkhfrppdqgvdgguhvvhvfrqwurovljqdovdqgforfnv 7kh io\e\ wrsrorj\ ehqhilwv iurp d uhgxfhg qxpehu ri vwxev dqg  wkhlu ohqjwkv krzhyhu io\e\ wrsrorj\ lqgxfhv ioljkw wlph vnhz ehwzhhq wkh forfndqg'46[vwureh dqg'4[ dwhdfk6'5$0lqwkhduud\&rqwuro - ohuvzlookdyhdgliilfxowwlphpdlqwdlqlqj t dqss, t dss and t '6+vshflilfd - wlrqvzlwkrxwvxssruwlqj:5,7(/(9(/,1*lqv\vwhpvzklfkxvhio\e\ wrsrorj\edvhgghvljqv:5,7(/(9(/,1*wlplqjdqgghwdlohgrshudwlrq lqirupdwlrqlvsurylghglqv:5,7(/(9(/,1* write leveling
logic devices incorporated www.logicdevices.com 92 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product $/lvvxssruwhgwrpdnhwkhfrppdqgdqggdwdexvhiilflhqwiruvxvwdlqdeohedqgzlgwkvlq''565$0v05>@ghilqhwkhydoxhri$/ vhh)ljxuh   05>@hqdeohvwkhxvhuwrsurjudpwkh''56'5$0zlwkdq$/ &/ru&/ :lwkwklvihdwxuhwkh''56'5$0hqdeohvd5($'ru:5,7(frppdqgwrehlvvxhgdiwhuwkh$&7,9$7 (frppdqgiruwkdwedqnsulru wr t 5&' 0,1 7kh rqo\uhvwulfwlrqlv$&7,9$7(wr5($'ru:5,7($/ t t 5&' 0,1 pxvwehvdwlvilhg$vvxplqj t 5&' 0,1  &/dw\slfdodssolfdwlrqxvlqjwklvihdwxuhvhwv $/ &/y t &.  t 5&' 0,1 t &.7kh5($'ru:5,7(frppdqglvkhogiruwkhwlphriwkh$/ehiruhlwlvuhohdvhglqwhuqdoo\wrwkh''56'5$0l02' ghylfh5($'odwhqf\ 5/ lvfrqwuroohge\wkhvxpriwkh$/dqg&$6odwhqf\ &/ 5/ $/&/:5,7(odwhqf\ :/ lvwkhvxpri &$6:5,7(odwhqf\dqg $/:/ $/&:/ vhhv02'(5(*,67(5 05 w([dpsohvri5($'dqg:5,7(odwhqflhvduhvkrzqlq)ljxuhdqg)ljxuh posted cas additive latency (al) f igure 47- read l atency (al = 5, cl = 6) ck ck# command dq dqs, dqs# active n t0 t1 dont care nop nop t6 t12 nop read n t13 nop do n+ 3 do n + 2 do n + 1 rl = al + cl = 11 t14 nop do n t rcd (min) al = 5 cl = 6 t11 bc4 indicates a break in time scale transitioning data t2 nop
logic devices incorporated www.logicdevices.com 93 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 48- m ode r egister 2 (mr2) d efinition notes: 1. mr2[16, 13:11, 8, and 2:0] are reserved for future use and must all be programmed to 0. m14 0 1 0 1 m15 0 0 1 1 mode register mode register set 0 (mr0) mode register set 1 (mr1) mode register set 2 (mr2) mode register set 3 (mr3) a9 a7 a 6 a5 a4 a3 a8 a2 a1 a0 mode register 2 (mr2) add ress bus 976543 8210 a10 a12 a11 1a b0 ab 10 11 121314 15 1 cw l 0 1 0 ba2 as r 16 0 1 a13 0 1 0 1 0 1 0 1 0 1 0 1 srt r tt _ wr m6 0 1 auto self refres h (optional) disabled: manual enabled: automatic m7 0 1 self refresh temperature normal (0 c to 85 c) extended (0c to 95 c) cas write latency (cwl) 5 ck ( t ck 2.5ns) 6 ck (2.5ns > t ck 1.875ns) 7 ck (1.875ns > t ck 1.5ns) 8 ck (1.5ns > t ck 1.25ns) reserved reserved reserved reserved m3 0 1 0 1 0 1 0 1 m4 0 0 1 1 0 0 1 1 m5 0 0 0 0 1 1 1 1 m9 0 1 0 1 m10 0 0 1 1 dynamic odt ( r tt _ wr ) r tt _ wr disabled rzq/4 rzq/2 reserved 7kh02'(5(*,67(5 05 frqwurovdgglwlrqdoixqfwlrqvdqgihdwxuhvqrwdydlodeohlqwkhrwkhuprghuhjlvwhuv7khvhdgglwlrqdoixqfwlrqvduh&$6 :5,7(odwhqf\ &:/ $8726(/)5()5(6+ $65 6(/)5()5(6+7(03(5$785( 657 dqg'<1$0,&2'7 5 tt b:5 7khvhixqfwlrqvduhfrq - wuroohgyldwkhelwvvkrzqlq)ljxuh7kh05lvsurjudpphgyldwkh056frppdqgdqgzloouhwdlqwkhvwruhglqirupdwlrqxqwlolwlvsurjudpphgdjdlqru xqwlowkhghylfhorvhvsrzhu5hsurjudpplqjwkh05uhjlvwhuzlooqrwdowhuwkhfrqwhqwvriwkhphpru\duud\surylghgwkdwwkhrshudwlrqkdvehhqshuiruphg fruuhfwo\7kh05uhjlvwhupxvwehordghgzkhqdooedqnvduhlgohdqgqrgdwdexuvwvduhlqsurjuhvvdqgwkhphpru\frqwuroohupxvwzdlwiruwkhvshflilhg wlph t mrd and t 02'ehiruhlqlwldwlqjdvxevhtxhqwrshudwlrq mode register 2 (mr2)
logic devices incorporated www.logicdevices.com 94 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 49- cas w rite l atency ck ck# command dq dqs, dqs# active n bc4 t0 t1 dont care nop nop t6 t12 nop write n t13 nop di n + 3 di n + 2 di n + 1 t14 nop di n t rcd (min) nop al = 5 t11 indicates a break in time scale wl = al + cwl = 11 transitioning data t2 cwl = 6 &:/lvghilqhge\05>@dqglvwkhghod\lqforfnf\fohviurpwkhuhohdvlqjriwkhlqwhuqdo:5,7(wrwkhodwfklqjriwkh iluvwgdwdlq&:/pxvwehfruuhfwo\ vhwwrwkhfruuhvsrqglqjrshudwlqjforfniuhtxhqf\ vhh)ljxuh  7khryhudoo:5,7(/$7(1&< :/ lvhtxdowr&:/$/ vhh)ljxuh  cas write latency (cwl) 0rghuhjlvwhu05>@lvxvhgwr',6$%/((1$%/(wkh$65ixqfwlrq :khq$65lv',6$%/('wkh6(/)5()5(6+prghuv5()5(6+udwh lvdvvxphgwrehdwwkhqrupdo?&olplw frpprqo\uhihuuhgwr dvwkh ;5()5(6+udwh ,qwkh',6$%/('prgh$65uhtxluhvwkhxvhu wr hqvxuhwkh6'5$0qhyhuh[fhhgvd7 $ ri?&zklohlq6(/)5()5(6+ xqohvvwkhxvhuhqdeohvwkh657ihdwxuholvwhgehorzvxssruwlq jdqhoh - ydwhgwhpsxswr?&zklohlq6(/)5()5(6+ 7kh vwdqgdug 6(/) 5()5(6+ fxuuhqw whvw vshflilhv whvw frqglwlrq v wr qrupdodpelhqwwhpshudwxuh ?& rqo\phdqlqjli$65lvhqdeohgwkh vwdqgdug6(/)5()5(6+fxuuhqwvshflilfdwlrqgrhvqrwdsso\ vhh wkh v(;7(1'('7(03(5$785(86$*(wghvfulswlrqodwhulqwklv'6  auto self refresh (asr) rswlrqdoh[whqghgwhpshudwxuhudqjhri?&zklohlq6(/)5()5(6+ prgh7khvwdqgdug6(/)5()5(6+fxuuhqwwhvwvshflilhvwhvwfrqglwlrqv wrqrupdodpelhqwwhpshudwxuh ?& rqo\phdqlqjli657lvhqdeohgwkh vwdqgdug6(/)5()5(6+fxuuhqwvshflilfdwlrqvgrqrwdsso\ srt vs. asr 0rgh uhjlvwhu 05>@ lv xvhg wr ',6$%/((1$%/( wkh 657 ixqfwlrq   :khq 657 lv 'lvdeohg wkh 6(/) 5()5(6+ prghuv uhiuhvk udwh lv dvvxphg wr eh dw wkh qrupdo ?& olplw  ,q wkh ',6$%/(' prgh 657 uhtxluhvwkhxvhuwrhqvxuhwkh6'5$0qhyhuh[fhhgvwkh t $ olplwri?& zklohlq6(/)5()5(6+prghxqohvvwkhxvhuhqdeohv$65 :khq657lvhqdeohgwkh6'5$06(/)5()5(6+lvfkdqjhglqwhuqdo o\ iurp;wr;uhjdugohvvriwkhdpelhqwwhpshudwxuh 7 $ 7klvhqdeohv wkhxvhuwrrshudwhwkh6'5$0eh\rqgwkhvwdqgdug?&olplwxswrwkh self refresh temperature (srt) ,iwkhqrupdodpelhqwwhpshudwxuholplwri?&lvqrwh[fhhghg wkhqqhl - wkhu 657 qru $65 lv uhtxluhg dqg erwk fdq eh ',6$%/(' wkurxjkr xw rshudwlrq,iwkhh[whqghgwhpshudwxuhrswlrqlvxvhgwkhxvhulvuhtxluhg wr surylgh d ; uhiuhvk udwh gxulqj pdqxdo  uhiuhvk iru ([whqghg whps ghylfhvru;uhiuhvkudwhiru0lowhpsghylfhv657dqg$65vkrxogeh hqdeohgirudxwrpdwlf5()5(6+vhuylfhvrqdooghylfhvxvhglqwhpshud - wxuhhqylurqphqwv d?& 657irufhvwkh6'5$0wrvzlwfkwkhlqwhuqdo6(/)5()5(6+udwhiurp ;wr;6(/)5()5(6+lvshuiruphgdw;uhjdugohvvrit $ . $65 dxwrpdwlfdoo\ vzlwfkhv wkh 6'5$0uv lqwhuqdo 6(/) 5()5(6+ ud wh iurp ; wr ; krzhyhu zkloh lq 6(/) 5()5(6+ prgh $65 hqdeohv  wkh 5()5(6+ udwh dxwrpdwlfdoo\ dgmxvw ehwzhhq ; dqg ; 5()5(6+  udwhryhuwkhvxssruwhgwhpshudwxuhudqjh2qhrwkhuglvdgydqwdjhzlwk $65lvwkh6'5$0fdqqrwdozd\vvzlwfkiurpd;wrd;uhiuhvkudwhdw dqh[dfwdpelhqw7hpshudwxuhri?&$owkrxjkwkh6'5$0zloo vxssruw gdwdlqwhjulw\zkhqlwvzlwfkhviurpd;wr;udwhlwpd\vzlwfkdwdorzhu whpshudwxuhwkdq?& 6lqfhrqo\rqhprghlvqhfhvvdu\dwrqhlqvwdqwlqwlph657dqg$65 fdqqrwehvlpxowdqhrxvo\hqdeohg
logic devices incorporated www.logicdevices.com 95 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product dynamic odt 7khprghuhjlvwhu 05 frqwurovdgglwlrqdoixqfwlrqvdqgihdwxuhvqrwdydlodeohyld0505ru05&xuuhqwo\ghilqhgdv wkh08/7,385326(5(*,6 - 7(5 035 7klvixqfwlrqlvfrqwuroohgyldwkhelwvvkrzqlq) ljxuh7kh05lvsurjudpphgyldwkh/2$'02'(frppdqgdqg uhwdlqvwkhvwruhglqiru - pdwlrqxqwlolwlvsurjudpphgdjdlqruxqwlowkhghylfhorvhvsrzhu5hsurjudpplqjwkh05uhjlvwhuzlooqrwdowhuwkhfrqwhq wvriwkhphpru\duud\surylghg wkhsurjudpplqjriwkh05kdv ehhqshuiruphgfruuhfwo\7kh0 5uhjlvwhupxvwehordghgzkhqdooedqnvduhlgohdqgqrgdwd exuvwvduhlqsurjuhvvdqg wkhphpru\frqwuroohupxvwzdlwwkhvshflilhgwlph t mrd and t 02'ehiruhlqlwldwlqjdvxevhtxhqwrshudwlrq mode register (mr3) 7khg\qdplf2'7 5 tt b:5 ihdwxuhlvghilqhge\05>@'\qdplf2'7lvhqdeohgzkhqdydoxhlvvhohfwhg7klvqhz''5ihdwxuhhqdeohvwkh2'7  whuplqdwlrqydoxhwrfkdqjhzlwkrxwlvvxlqjdq056frppdqghvv hqwldoo\fkdqjlqjwkh2'7whuplqdwlrqvrqwkhio\w :lwk g\qdplf 2'7 5 tt b:5  zkhq ehjlqqlqj d :5,7( exuvw dqg vxevhtxhqwo\ vzlwfkhv edf nwr2'7 5 tt b:5  lv hqdeohg 2'7/&1: 2'7/&1: 2'7/&1: 2'7+2'7+dqg t $'& '\qdplf2'7lvrqo\dssolfdeohgxulqj:5,7(f\fohv,i2'7 5 tt b120 lvglvdeohgg\qdplf2'7 5 tt b:5 lvvwlooshuplwwhg5 tt _nom and r tt b:5fdq ehxvhglqghshqghqwrirqhdqrwkhu'\qdplf2'7lvqrwdydlode ohgxulqj:5,7(/(9(/,1*prghuhjdugohvvriwkhvwdwhri2'7 5 tt b120 )rughwdlov rq2'7rshudwlrquhihuwrwkhv2q'lh7huplqdwlrq 2'7 wvhfwlrq f igure 50 - m ode r egister 3 (mr3) d efinition a9 a7 a 6 a5 a4 a3 a8 a2 a1 a0 mode register 3 (mr3) add ress bus 976543 8210 a10 a12 a11 1a b0 ab 10 11 121314 15 a13 10 1 0 1 0 1 0 1 0 1 0 1 0 1 mpr 1 ba2 16 0 1 0 1 0 1 0 1 0 1 m2 0 1 mpr enable normal dram operations 2 dataflow from mpr mpr_rf m14 0 1 0 1 m15 0 0 1 1 mode register mo de register set (mr0) mode register set 1 (mr1) mode register set 2 (mr2) mode register set 3 (mr3) mpr read func tion predefined pattern 3 reserved reserved reserved m0 0 1 0 1 m1 0 0 1 1 127(6 1. 05>dqg@duhuhvhuyhgiruixwxuhxvhdqgpxvwdooehsurjudpphgwrvw 2. :khq035frqwurolvvhwiruqrupdo'5$0rshudwlrq05>@zlooehljqruhg 3. ,qwhqghgwrehxvhgiru5($'v\qfkurql]dwlrq
logic devices incorporated www.logicdevices.com 96 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product multipurpose register (mpr) 7kh08/7,385326(5(*,67(5ixqfwlrqlvxvhgwrrxwsxwdsuhghilqhgv\vwhpwlplqjfdoleudwlrqelwvhtxhqfh%lwlvwkhpdvwhuelwwkdwhqdeohvruglvdeohv dffhvvwrwkh035uhjlvwhudqgelwvdqgghwhuplqhzklfkprghwkh035lvsodfhglq7khedvlffrqfhswriwkhpxowlsxusrvhuhjlvwhulvvkrzqlq)ljxuh ,i05>@lvdvwwkhqwkh035dffhvvlvglvdeohgdqgwkh6'5$0rshudwhvlqqrupdoprgh+rzhyhuli05>@lvdvwwkhq6'5$0qrorqjhurxwsxwv qrupdouhdggdwdexwrxwsxwv035gdwddvghilqhge\05>@ ,i05>@lvhtxdowrvwwkhqdsuhghilqhguhdgsdwwhuqir uv\vwhpfdoleudwlrqlvvhohfwhg 7rhqdeohwkh035wkh056frppdqglvlvvxhgwr05dqg05>@  vhh7deoh 3ulruwrlvvxlqjwkh056frppdqgdooedqnvpxvwehlqwkhlgohvwdwh dooedqnvduhsuhfkdujhgdqg t 53lvphw :khqwkh035lvhqdeohgdq\vxevhtxhqw5($'ru5'$3frppdqgvduhuhgluhfwhgwrwkhpxowlsxusrvhuhjlvwhu  7khuhvxowlqjrshudwlrqzkhqhlwkhud5($'rud5'$3frppdqglvlvvxhglvghilqhge\05>@zkhq035lvhqdeohg vhh7deoh :khqwkh035lv hqdeohgrqo\5($'ru5'$3frppdqgvduhdoorzhgxqwlodvxevhtxhqw056frppdqglvlvvxhgzlwkwkh035glvdeohg 05>@  32 :(5'2:16(/) 5()5(6+dqgdq\rwkhu1215($'ru5'$3frppdqglvqrwdoorzhg7kh5(6(7ixqfwlrqlvvxssruwhggxulqj035hqdeohprgh f igure 51 - m ultipurpose r egister (mpr) b lock d iagram memory core mr3[2] = 0 (mpr off) dq, dm, dq s, dqs# multipurpose register pre defined data for reads mr3[2] = 1 (mpr on) 127(6 1. $suhghilqhggdwdsdwwhuqfdqehuhdgrxwriwkh035zlwkdqh[whuqdo5($'frppdqg 2. 05>@ghilqhvzkhwkhuwkhgdwdiorzfrphviurpwkhphpru\fruhruwkh035:khqwkhgdwd iorz lv ghilqhg wkh 035 frqwhqwv fdq eh uhdg rxw frqwlqxrxvo\ zlwk d uhjxodu 5($' ru 5'$3 frppdqg
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product mpr mpr read function function 0 1 1rupdo2shudwlrqqr035wudqvdfwlrq$oovxevhtxhqw5($'vfrphiurp wkh6'5$0phpru\duud\$oovxevhtxhqw:5,7(vjrwrwkh6'5$0 phpru\duud\ (qdeoh035prghvxevhtxhqw5($'5'$3frppdqgvghilqhge\elwv  and 2. t able 61: burst order v'rquw&duhw $>@ 6hh7deoh mr3[2] mr3[1:0] mpr functional description 7kh035-('(&ghilqlwlrqdoorzviruhlwkhudsulph'4iruorzhue\whdqg'4iruwkhxsshue\whrihdfkriwkh  zrugvfrqwdlqhglqwkh/',l02'wrrxwsxw wkh035gdwdzlwkwkhuhpdlqlqj'4vgulyhq/2:ruirudoo'4vwrrxwsxwwkh035gdwd7kh035uhdgrxwvxssruwvil[hg5($'exuvwdqg5($'exuvwfkrs 056dqg27)yld$%& zlwkuhjxodu5($'odwhqflhvdqg$&wlplqjvdssolfdeoh7klvsurylglqjwkh'//lvorfnhgdvuhtxluhg  035dgguhvvlqjirudydolg0355($'lvdviroorzv x$>@pxvwehvhwwrvwdvwkhexuvwrughulvil[hgshuql eeoh x$vhohfwvwkhexuvwrughu x%/$lvvhwwrvwdqgwkhexuvwrughulvil[hgwr x)ruexuvwfkrsfdvhvwkhexuvwrughulvvzlwfkhgrqwkhql eeohedvhdqg x$ exuvwrughu  x$ exuvwrughu  x%xuvwrughuelw wkhiluvwelw lvdvvljqhgwr/6%dqgexuvwrughuelw wkhodvwelw lvdvvljqhgwr06% x$>@duhdv'rquw&duhw x$lvdv'rquw&duhw x$lvdv'rquw&duhw x$6hohfwvexuvwfkrsprghrqwkhio\lihqdeohgzlwklq05 x$lvdv'rquw&duhw x%$>@duhdv'rquw&duhw
logic devices incorporated www.logicdevices.com 98 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product mpr register address definitions and bursting order 7kh035fxuuhqwo\vxssruwvdvlqjohgdwdirupdw7klvgdwdirupdwlvdsuhghilqhg5($'sdwwhuqiruv\vwhpfdoleudwlrq7khs uhghilqhgsdwwhuqlvdozd\vd uhshdwlqjelwsdwwhuq ([dpsohvriwkhgliihuhqww\shrisuhghilqhg5($'sdwwhuqexuvwvduhvkrzqlq)ljxuhvdqg mr3[2] mr3[1:0] function length a[2:0] burst order and data pattern 1 1 1 1 %xuvw2ughu 3uhghilqhgsdwwhuq burst order: 0,1,2,3 3uhghilqhgsdwwhuq %xuvw2ughu 3uhghilqhgsdwwhuq n/a n/a n/a n/a n/a n/a n/a n/a n/a t able 62: burst order 5($'suhghilqhgsdwwhuqiru v\vwhpfdoleudwlrq 5)8 5)8 5)8 bl8 %& %& n/a n/a n/a n/a n/a n/a n/a n/a n/a 000 000 100 n/a n/a n/a n/a n/a n/a n/a n/a n/a 00 01 10 11 burst read
logic devices incorporated www.logicdevices.com 99 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. read with bl8 either by mrs or otf. 2. memory controller must drive 0 on a[2:0]. t0 ta0 tb0 tb 1 tc0 tc1 tc2 tc3 tc4 tc5 tc 6 tc7 tc8 tc9 tc1 0 ck ck # mrs prea read 1 nop nop nop nop nop nop nop nop mrs nop nop valid command t mprr don t care indicates a break in time scale dqs, dqs# bank add ress 3 vali d 3 0 a[1:0] vali d 0 2 1 a2 0 2 0 00 a[9:3] vali d 00 0 1 a10/ap vali d 0 0i lav 11a d 0 0 a12/bc# vali d 1 0 0i lav ]31:51[a d 0 dq t mod t rp t mod rl figure 52 - mpr system read calibration with bl8: fixed burst order single readout
logic devices incorporated www.logicdevices.com 100 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. read with bl8 either by mrs or otf. 2. memory controller must drive 0 on a[2:0]. t0 ta tb tc0 tc1 tc2 tc3 tc4 tc5 tc 6 tc7 tc8 tc9 tc1 0 td ck ck# t mprr don t care indicates a break in time scale rl 3 vali d 3 bank add ress vali d a[1:0] vali d 0 2 0 2 0 a2 1 2 0 2 1 0 0 a[15:13] vali d vali d 0 a[9:3] vali d vali d 00 00 a11 vali d vali d 0 0 a12/bc# vali d 1 0 0 a10/ap vali d vali d 0 0 1 rl prea read 1 nop nop nop no nop nop nop mrs vali d command read 1 mrs dq vali d dqs, dqs# t rp t mod t ccd t mod nop nop figure 53 - mpr system read calibration with bl8: fixed burst order, back-to-back readout
logic devices incorporated www.logicdevices.com 101 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. read with bc4 either by mrs or otf. 2. memory controller must drive 0 on a[1:0]. 3. a2 = 0 selects lower 4 nibble bits 0 . . . 3. 4. a2 = 1 selects upper 4 nibble bits 4 . . . 7. t0 ta tb ck ck# dq dqs, dqs# t mod t mprr don t care tc0 tc1 tc2 tc3 tc4 tc5 tc6 tc7 tc8 tc9 tc10 td nop nop nop nop valid command mrs prea read 1 read 1 nop nop indicates a break in time scale bank add ress 3 vali d 3 vali d 0 a[1:0] vali d 0 2 0 2 1 a2 1 4 0 3 0 00 ilav ]3:9[a d vali d 00 0 1i lav pa/01a d vali d 0 0i lav 11a d vali d 0 0 a12/bc# vali d 1 vali d 1 0 0 a[15:13] vali d vali d 0 rl rl t rf t mod t ccd nop nop mrs nop figure 54 - mpr system read calibration with bc4: lower nibble, then upper nibble
logic devices incorporated www.logicdevices.com 102 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. read with bc4 either by mrs or otf. 2. memory controller must drive 0 on a[1:0]. 3. a2 = 1 selects upper 4 nibble bits 4 . . . 7. 4. a2 = 0 selects lower 4 nibble bits 0 . . . 3. t0 ta tb 0 1i lav pa/01a dvalid 0 ck ck# mrs prea read 1 read 1 nop nop nop s nop nop valid command 0 0 4 1 3 1 a2 t mod t mprr 3valid 3 bank add ress vali d 0 2 0 2 0 a[1:0] vali d 0 0i lav ]31:51[a dvalid 0 0i lav 11a d vali d 00 00 ilav ]3:9[a dvalid don t care tc0tc1tc2tc3tc4tc5tc6tc7tc8tc9tc10td indicates a break in time scale rl dq dqs, dqs# 0 a12/bc# vali d 1 vali d 1 0 rl t rf t mod t ccd mr nop nop nop nop figure 55 - mpr system read calibration with bc4: upper nibble, then lower nibble
logic devices incorporated www.logicdevices.com 103 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product mpr read predefined pattern 7khsuhghwhuplqhg5($'fdoleudwlrqsdwwhuqlvdil[hgsdwwhuqri7khiroorzlqjlvdqh[dpsohrixvlqjwkh5($'rxwsuhghwhuplqhg5($' fdoleudwlrqsdwwhuq7khh[dpsohlvwrshuiruppxowlsoh5($'6iurpwkh08/7,385326(5(*,67(5 035 lqrughuwrgrv\vwhpohyh o5($'wlplqjfdoleud - wlrqedvhgrqwkhsuhghwhuplqhgdqgvwdqgdugl]hgsdwwhuq 7khiroorzlqjsurwrfrorxwolqhvwkhvwhsvxvhgwrshuirupwkh5($'fdoleudwlrq x3uhfkdujhdooedqnv x$iwhu t 53lvvdwlvilhgvhw05605>@ dqg05>@ 7klvuhg luhfwvdoovxevhtxhqw5($'vdqg/rdgvwkhsuhghilqhgsdwwhuqlq wr wkh035$vvrrqdv t mrd and t 02'duhvdwlvilhgwkh035lvdydlodeoh x'dwd:5,7(rshudwlrqvduhqrwdoorzhgxqwlowkh035uhwxuqvwrwkhqrupdo6'5$0vwdwh x,vvxhd5($'zlwkexuvwrughulqirupdwlrq doorwkhudgguhvvslqvduhv'rquw&duhw  x$>@  gdwdexuvwrughulvil[hgvwduwlqjdwqleeoh x$  iru%/exuvwrughulvil[hgdv x$  xvh%/ x$iwhu5/ $/&/wkh6'5$0exuvwvrxwwkhsuhghilqhg5($'fdoleudwlrqsdwwhuq   x7khphpru\frqwuroohuuhshdwvwkhfdoleudwlrq5($'vxqwlo5($ 'gdwdfdswxuhdwwkhphpru\frqwuroohulvrswlpl]hg x$iwhuwkhodvw0355($'exuvwdqgdiwhu t 0355kdvehhqvdwlvilhglvvxh05605>@ dqg05>@ v'rquw&duhwwrwkhqrupdo 6'5$0vwdwh$oovxevhtxhqw5($'dqg:5,7(dffhvvhvzlooehuhjxodu5($'6dqg:5,7(6iurpwrwkh6'5$0duud\ x:khq t mrd and t 02'duhvdwlvilhgiurpwkhodvw056wkhuhjxodu6'5$0frppdqgv vxfkdv$&7,9$7(d0hpru\edqniruuhjxodu 5($'ru:5,7(dffhvv duhshuplwwhg mode register set (mrs) 7khprghuhjlvwhuvduhordghgyldlqsxwv%$>@$>@%$>@ghwhuplqhvzklfkprghuhjlvwhulvsurjudpphg x%$ %$ %$ iru05 x%$ %$ %$ iru05 x%$ %$ %$ iru05 x%$ %$ %$ iru05 7kh056frppdqgfdqrqo\ehlvvxhg ruuhlvvxhg zkhqdooedqnvduhlgohdqglqwkhsuhfkdujhgvwdwh t 53lvvdwlvilhgdqgqrgdwdexuvwvduhlq surjuhvv 7khfrqwuroohupxvwzdlwwkhvshflilhgwlph t 05'ehiruhlqlwldwlqjdvxevhtxhqwrshudwlrqvxfkdvdq$&7,9$7(frppdqg7khuhlvdovr duhvwulfwlrqdiwhulvvxlqjdq056frppdqgzlwkuhjdugwrzkhqwkhxsgdwhgixqfwlrqvehfrphdydlodeoh7klvsdudphwhulvvshflilhge\ t mod. both t mrd and t 02'sdudphwhuvduhvkrzqlq)ljxuhdqg9lrodwlqjhlwkhuriwkhvhuhtxluhphqwvzloouhvxowlqxqvshflilhgrshudwlrq zq calibration 7kh=4&$/,%5$7,21frppdqglvxvhgwrfdoleudwhwkh6'5$0rxwsxwgulyhuv 521 dqg2'7ydoxhv 5 tt ryhusurfhvvyrowdjhdqgwhpshudwxuhsur - ylghgdghglfdwhg : ? h[whuqdouhvlvwrulvfrqqhfwhgiurpwkh6'5$0uv=4edoowr9vv4 ''56'5$0vqhhgdorqjhuwlphwrfdoleudwh5 on dqg2'7dwsrzhuxs,1,7,$/,=$ 7,21dqg6(/)5()5(6+h[lwdqgd uhodwlyho\vkruwhuwlphwrshuirup shulrglffdoleudwlrqv''56'5$0ghilqhvwzr=4&$/,%5$7,21f rppdqgv=4&$/,%5$7,21/21* =4&/ dqg=4&$/,%5$7,216+257 =4&6  $qh[dpsohri=4&$/,%5$7,21wlplqjlvvkrzqlq)ljxuh $ooedqnvpxvweh35(&+$5*('dqg t 53pxvwehphwehiruh=4&/ru=4&6frppdqgvfdqehlvvxhgwrwkh6'5$01rrwkhudfwlylwlhv rwkhuwkdqdqrwkhu =4&/ru=4&6frppdqgpd\ehlvvxhgwrwkh6'5$0 fdqehshuiruphgrqwkh6'5$0duud\e\wkhfrqwuroohuiruwkhgxudwlrqri t =4,1,7ru t =423(5  7khtxlhwwlphrqwkh6'5$0duud\khosvdffxudwho\fdoleudwh5 on dqg2'7$iwhu6'5$0fdoleudwlrqlvdfklhyhgwkh6'5$0vkrxogglvdeohwkh=4edoouv fxuuhqwfrqvxpswlrqsdwkwruhgxfhryhudoosrzhuxvdjh =4&$/,%5$7,21frppdqgvfdqehlvvxhglqsdudoohowr'//5(6(7dqgorfnlqjwlph8srq6(/)5()5(6+h[lwdqh[solflw=4&/lv uhtxluhgli=4&$/, - %5$7,21lvghvluhg ,qgxdoudqnv\vwhpghvljqvwkdwvkduhwkh=4uhvlvwruehwzhhqghylfhvwkhfrqwuroohupxvwqrwdoorzryhuodsri t =4,17 t =423(5ru t =4&6ehwzhhqudqnv
logic devices incorporated www.logicdevices.com 104 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 56 - zq c alibration t iming (zqcl and zqcs) nop zqcl nop nop valid vali d zqcs nop nop nop valid command indicates a break in time scale t0 t1 ta0 ta1 ta2 ta3 tb0 tb1 tc0 tc1 tc2 address vali d vali d vali d a10 vali d vali d vali d ck ck# don t care dq high-z high-z 3 a 3 ctivities activ- ities vali d vali d odt 2 2 vali d 1 ck e 1 vali d vali d vali d t zqcs t zq init or t zq oper 127(6 1. &.(pxvwehfrqwlqxrxvo\uhjlvwhuhg+,*+gxulqjwkhfdoleudwlrqsurfhgxuh 2. 2'7pxvwehglvdeohgyldwkh2'7vljqdoruwkh056gxulqjwkhfdoleudwlrqsurfhgxuh 3. $ooghylfhvfrqqhfwhgwrwkh'4exvvkrxogeh+ljk=gxulqjfdoleudwlrq activate %hiruhdq\5($'ru:5,7(frppdqgvfdqehlvvxhgwrdedqnzlwkl qwkh6'5$0d52:lqwkdwedqnpxvwehrshqhg $&7,9$7(' 7k lvlvdffrpsolvkhg yldwkh$&7,9$7(frppdqgzklfkvhohfwverwkwkh%$1.dqgwkh52:wreh$&7,9$7(' $iwhud52:lvrshqhgzlwkdq$&7,9$7(frppdqgd5($'ru:5,7( frppdqgpd\ehlvvxhgwrwkdw52:vxemhfwwrwkh t 5&'vshflilfdwlrq+rzhyhuli wkhdgglwlyhodwhqf\lvsurjudpphgfruuhfwo\d5($'ru:5,7(frppdqgpd\ehlvvxhgsulruwr t 5&' 0,1 ,qwklvrshudwlrqwkh6'5$0hqdeohvd5($' ru:5,7(frppdqgwrehlvvxhgdiwhuwkh$&7,9$7(frppdqgiruwk dwedqnexwsulruwr t 5&' 0,1  vhhv3267('&$6$'',7,9(/$7(1&< $/  t 5&' 0,1 vkrxogehglylghge\wkhforfnshulrgdqgurxqghgxswrwkhqh[wzkrohqxpehuwrghwhuplqhwkhhduolhvwforfnhgjhdiwhu wkh$&7,9$7(frppdqgrq zklfkwkh5($'ru:5,7(frppdqgfdqehhqwhuhg7khvdphsurfhgxuhlvxvhgwrfrqyhuwrwkhuvshflilfdwlrqolplwviurpwlphxqlwvwrforfnf\fohv :khqdwohdvwrqhedqnlvrshqdq\5($'wr5($'frppdqgghod\ ru:5,7(wr:5,7(frppdqgghod\lvuhvwulfwhgwr t &&' 0,1  $ vxevhtxhqw $&7,9$7( frppdqg wr d gliihuhqw 52: lq wkh vdph %$1. fdq rqo\ eh lvvxhg diwhu wkh suhylrxv $&7,9( 52: kdv ehhq forvhg 35( - &+$5*(' 7khplqlpxpwlphlqwhuydoehwzhhqvxffhvvlyh$&7,9$7(frppdqgvwrwkhvdph%$1.lvghilqhge\ t 5& $vxevhtxhqw$&7,9$7(frppdqgwrdqrwkhu%$1.fdqehlvvxhgzklohwkhiluvw%$1.lvehlqjdffhvvhgzklfkuhvxowvlqduhgxfwlrqriwrwdo52:$&&(66 ryhukhdg7khplqlpxpwlphlqwhuydoehwzhhqvxffhvvlyh$&7,9$7(frppdqgvpd\ehlvvxhglqdjlyhq t )$: 0,1 shulrgdqgwkh t 55' 0,1 uhvwulfwlrq still applies. the t )$: 0,1 sdudphwhudssolhvuhjdugohvvriwkhqxpehuri%$1.6douhdg\rshqhgruforvhg
logic devices incorporated www.logicdevices.com 105 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 57 - e xample : m eeting t rrd (min) and t rcd (min) command don t care t1 t0 t2 t3 t4 t5 t8 t9 t rrd row row co l bank x bank y bank y nop act nop nop act nop nop rd/wr t rcd ba[2:0] ck # add ress ck t10 t11 nop nop indicates a break in time scale f igure 58 - e xample : t faw command don t care t1 t0 t4 t5 t8 t9 t10 t11 t rrd row row bank a bank b row bank c row bank d bank y row bank y nop act nop ac a tctnop nop t faw ba[2:0] ck # add ress ck t19 t20 nop ac a tc t bank e indicates a break in time scale
logic devices incorporated www.logicdevices.com 106 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 59 - read l atency notes: 1. do n = data-out from column n. 2. subsequent elements of data-out appear in the programmed order following do n. . ck ck # command read nop nop nop nop nop nop nop add ress bank a, col n cl = 8, al = 0 dq dqs, dqs# do n t0 t7 t8 t9 t10 t11 don t care transitioning data t12 t12 indicates a break in time scale read 5($'exuvwvduhlqlwldwhgzlwkd5($'frppdqg7khvwduwlqj&2/801dqg%$1.dgguhvvhvduhsurylghgzlwkwkh5($'frppdqgdqg $87235( - &+$5*(lvhlwkhuhqdeohgruglvdeohgiruwkdwexuvwdffhvv,i $87235(&+$5*(lvhqdeohgwkh52:ehlqjdffhvvhglvdxwrpdwlf doo\35(&+$5*('dw wkhfrpsohwlrqriwkhexuvwvhtxhqfh,i$87235(&+$5*(lvglvdeohgwkh52:zlooehohiwrshqdiwhuwkhfrpsohwlrqriwkhexuvw 'xulqj5($'exuvwvwkhydolggdwdrxwhohphqwiurpwkhvwduwlq jfroxpqdgguhvvlvdydlodeohdw5($'/$7(1&< 5/ forfnvodwhu 5/lvghilqhgdvwkhvxp ri3267('&$6$'',7,9(/$7(1&< $/ dqg&$6/$7(1&< &/  5/ $/&/ 7khydoxhri$/dqg&/lvsurjudppdeohlqwkhprghuhjlvwhuyldwkh 056frppdqg(dfkvxevhtxhqwgdwdrxwhohphqwzlooehydolgqrplqdoo\dwwkhqh[wsrvlwlyhruqhjdwlyhforfnhgjh wkdwlvdwwkhqh[wfurvvlqjri&.dqg &.? )ljxuhvkrzvdqh[dpsohri5/edvhgrqd&/vhwwlqjridvzhoodv$/  $5($'exuvwpd\ehiroorzhge\d35(&+$5*(frppdqgwrwkhvdph  edqn surylghg $872 35(&+$5*( lv qrw $&7,9$7('  7kh plqlpxp 5($'wr35(&+$5*(frppdqgvsdflqjwrwkhvdphedqnlvirxuforf nv dqgpxvwdovrvdwlvi\dplqlpxpdqdorjwlphiurpwkh5($'frppd qg 7klvwlphlvfdoohg t 573 5($'wr35(&+$5*(  t 573vwduwv$/f\fohv odwhuwkdqwkh5($'frppdqg([dpsohviru%/duhvkrzqlq)ljxuh dqg%&lq)ljxuh)roorzlqjwkh35(&+$5*(frppdqgdvxevh - txhqwfrppdqgwrwkhvdphedqnfdqqrwehlvvxhgxqwlo t 53lvphw7kh 35(&+$5*(frppdqgiroorzhge\dqrwkhu35(&+$5*(frppdqgwr wkhvdphedqnlvdoorzhg+rzhyhuwkhsuhfkdujhshulrgzlooehghwhu - plqhge\wkhodvw35(&+$5*(frppdqglvvxhgwrwkhedqn ,i$lv+,*+zkhqd5($'frppdqglvlvvxhgwkh5($'zlwk$87 2 35(&+$5*( ixqfwlrq lv hqjdjhg  7kh 6'5$0 vwduwv dq $872 35( - &+$5*(rshudwlrqrqwkhulvlqjhgjhzklfklv$/ t 573f\fohvdiwhuwkh 5($' frppdqg  ''5 6'5$0v vxssruw d t 5$6 orfnrxw ihdwxuh vhh )ljxuh ,i t 5$6 0,1 lvqrwvdwlvilhgdwwkhhgjhwkhvwduwlqjsrlqwri wkh$87235(&+$5*(rshudwlrqzlooehghod\hgxqwlo t 5$6 0,1 lvvdw - lvilhg,qfdvhwkhlqwhuqdo35(&+$5*(rshudwlrqlvsxvkhgrxw e\ t rtp, t 53vwduwvdwwkhsrlqwdwzklfkwkhlqwhuqdo35(&+$5*(kdsshqv7kh wlph iurp 5($' zlwk $872 35(&+$5*( wr wkh qh[w $&7,9$7( frp - pdqgwkhvdphedqnlv$/ t 573 t 53 zkhuhv wphdqvurxqghgxs wrwkhqh[wlqwhjhu,qdq\hyhqwlqwhuqdo5(&+$5*(grhvqrwvwduwhduolhu wkdqirxuforfnvdiwhuwkhodvwqelwsuhihwfk />8@'46[/>8@'46[?lvgulyhqe\wkh6'5$0dorqjzlwkwkhrxwsx wgdwd 7khlqlwldo/2:vwdwhrq/>8@'46[dqg+,*+vwdwhrq/>8@'46[? lvnqrzq dvwkh5($'suhdpeoh t 535( 7kh/2:vwdwhrq'46[dqgwkh+,*+ vwdwhrq/>8@'46[?frlqflghqwzlwkwkhodvwgdwdrxwhohphqwlvnqrzqdv wkh5($'srvwdpeoh t 5367 8srqfrpsohwlrqridexuvwdvvxplqjqr rwkhufrppdqgvkdyhehhqlqlwldwhgwkh'4zloojr+,*+=$ghwdlohg h[sodqdwlrqri t '464 ydolggdwdrxwvnhz  t 4+ gdwdrxwzlqgrzkrog  dqgwkhydolggdwdzlqgrzduhghslfwhglq)ljxuh$ghwdloh gh[sodqd - wlrqri t '46&. '46wudqvlwlrqvnhzwr&. lvdovrghslfwhglq)ljxuh 'dwdiurpdq\5($'exuvwpd\ehfrqfdwhqdwhgzlwkgdwdiurpdvxevh - txhqw5($'frppdqgwrsurylghdfrqwlqxrxviorzrigdwd7khiluvwgdwd hohphqwiurpwkhqhzexuvwiroorzvwkhodvwhohphqwridfrpsoh whgexuvw 7kh qhz 5($' frppdqg vkrxog eh lvvxhg t &&' f\fohv diwhu wkh iluvw 5($'frppdqg7klvlvvkrzqiru%/lq)ljxuh,i%&lvhqdeohg t &&'pxvwvwlooehphwzklfkzloofdxvhdjdslqwkhgdwdrxwsxwdvvkrzq lq)ljxuh1rqfrqvhfxwlyh5($'gdwdlvuhiohfwhglq)ljxuh''5 6'5$0vgrqrwdoorzlqwhuuxswlqjruwuxqfdwlqjdq\5($'exuvw 'dwdiurpdq\5($'exuvwpxvwehfrpsohwhgehiruhdvxevhtxhqw :5,7( exuvwlvdoorzhg$qh[dpsohrid5($'exuvwiroorzhge\d:5, 7(exuvw iru %/ lv vkrzq lq )ljxuh   7r hqvxuh wkh 5($' gdwd lv frpsohwhg ehiruhwkh:5,7(gdwdlvrqwkhexvwkhplqlpxp5($'wr:5,7(wlplqj lv5/ t &&'y:/ t &.
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. the bl8 setting is activated by either mr0[1:0] = 00 or mr0[1:0] = 01 and a12 = 1 during read command at t0 and t4. 3. do n (or b) = data-out from column n (or column b). 4. bl8, rl = 5 (cl = 5, al = 0). t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 don t care transitioning data t12 t13 t14 t rpst nop d aer daer pon pon pon pon pon pon pon pon pon pon pon pon ck ck# c ommand 1 dq 3 dqs, dqs# bank, col n bank, co l b add ress 2 rl = 5 t rpre t ccd rl = 5 do n+ 3 do n+ 2 do n + 1 do n do n+ 7 do n + 6 do n + 5 do n+ 4 do b + 3 do b + 2 do b+ 1 do b do b + 7 do b + 6 do b + 5 do b+ 4 figure 60 - consecutive read bursts (bl8)
logic devices incorporated www.logicdevices.com 108 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. the bc4 setting is activated by either mr0[1:0] = 10 or mr0[1:0] = 01 and a12 = 0 during read command at t0 and t4. 3. do n (or b) = data-out from column n (or column b). 4. bc4, rl = 5 (cl = 5, al = 0). nop ck ck# comman d 1 dq 3 dqs, dqs# t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 address 2 t10 t11 don t care transitioning data t12 t1 3t14 read read nop nop nop nop nop nop nop nop nop nop nop nop bank, col n bank, col b t rpst t rpre t rpst t rpre rl = 5 do n+ 3 do n + 2 do n + 1 do n do b+ 3 do b+ 2 do b+ 1 do b rl = 5 t ccd figure 61 - consecutive read bursts (bc4)
logic devices incorporated www.logicdevices.com 109 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. al = 0, rl = 8. 2. do n (or b) = data-out from column n (or column b). 3. seven subsequent elements of data-out appear in the programmed order following do n. 4. seven subsequent elements of data-out appear in the programmed order following do b. don t care transitioning data t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 t12 t13 t14 t15 t16 t17 dqs, dqs# command nop nop nop nop nop nop nop nop nop nop nop nop nop nop nop read nop read add ress bank a, co l n bank a, col b ck ck # dq do n do b c l = 8 c l = 8 figure 62 - nonconsecutive read bursts
logic devices incorporated www.logicdevices.com 110 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. the bl8 setting is activated by either mr0[1:0] = 00 or mr0[1:0] = 01 and a12 = 1 during the read command at t0, and the write command at t6. don t care transitioning data t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 t12 t13 t14 t15 ck ck # command 1 nop nop nop nop nop write nop nop nop nop nop nop nop nop nop t wpst t rpre t wpre t rpst dqs, dqs# dq 3 wl = 5 t wr t wtr read do n do n + 1 do n + 2 do n + 3 do n + 4 do n + 5 do n + 6 do n + 7 di n di n + 1 di n + 2 di n + 3 di n + 4 di n + 5 di n + 6 di n + 7 read-to-write command delay = rl + t ccd + 2 t ck - wl t bl = 4 clocks add ress 2 bank, col b bank, col n rl = 5 figure 63 - read (bl8) to write (bl8)
logic devices incorporated www.logicdevices.com 111 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. the bc4 otf setting is activated by mr0[1:0] and a12 = 0 during read command at t0 and write command at t4. 3. do n = data-out from column n; di n = data-in from column b. 4. bc4, rl = 5 (al - 0, cl = 5), wl = 5 (al = 0, cwl = 5). don t care transitioning data t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 t12 t13 t14 t15 ck ck# add ress 2 bank, col n bank, col b command 1 read nop nop nop write nop nop nop nop nop nop nop nop nop nop nop t wpst t wpre t rpst dqs, dqs# dq 3 wl = 5 read-to-write command delay = rl + t cc d/2 + 2 t ck - wl t wr t wtr t bl = 4 clo cks t rpre rl = 5 do n do n+ 1 do n+ 2 do n + 3 di n di n + 1 di n + 2 di n+ 3 figure 64 - read (bc4) to write (bc4) otf
logic devices incorporated www.logicdevices.com 112 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. the bl8 setting is activated by either mr0[1:0] = 00 or mr0[1:0] = 01 and a12 = 1 during the read command at t0, and the write command at t6. 3. do n = data-out from column, di b = data-in for column b. 4. bl8, rl = 5 (al = 0, cl = 5), wl = 5 (al = 0, cwl = 5). don t care transitioning data t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 t12 t13 t14 t15 ck ck # command 1 nop nop nop nop nop write nop nop nop nop nop nop nop nop nop t wpst t rpre t wpre t rpst dqs, dqs# dq 3 wl = 5 t wr t wtr read do n do n + 1 do n + 2 do n + 3 do n + 4 do n + 5 do n + 6 do n + 7 di n di n + 1 di n + 2 di n + 3 di n + 4 di n + 5 di n + 6 di n + 7 read-to-write command delay = rl + t ccd + 2 t ck - wl t bl = 4 clocks add ress 2 bank, col b bank, col n rl = 5 figure 65 - read to precharge (bl8)
logic devices incorporated www.logicdevices.com 113 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product ck ck# don t care transitioning data t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 t12 t13 t14 t15 t16 t17 command nop nop nop nop nop nop nop nop nop act nop nop nop nop nop read nop pre add ress bank a, col n bank a, (or all) bank a, row b t rp t rtp dqs, dqs# dq do n do n+ 1 do n+ 2 do n+ 3 t ras figure 66 - read to precharge (bc4)
logic devices incorporated www.logicdevices.com 114 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product ck ck# command dq dqs, dqs# active n t0 t1 dont care nop nop t6 t12 nop read n t13 nop do n+ 3 do n + 2 do n + 1 rl = al + cl = 11 t14 nop do n t rcd (min) al = 5 cl = 6 t11 bc4 indicates a break in time scale transitioning data t2 nop figure 67 - read to precharge (al = 5, cl = 6)
logic devices incorporated www.logicdevices.com 115 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product ck ck # command nop nop nop nop add ress dq dqs, dqs# don t care transitioning data nop nop nop nop nop t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 t12 t13 ta0 t rtp (min) nop read nop al = 4 nop nop cl = 6 nop t ras (min) act indicates a break in time scale t rp bank a, col n bank a, row b do n do n+ 1 do n+ 2 do n+ 3 figure 68 - read with auto precharge (al = 4, cl = 6)
logic devices incorporated www.logicdevices.com 116 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product $'46[wr'4rxwsxwwlplqjlvvkrzqlq)ljxuh7kh'4wudqvlwlrqvehwzhhqydolggdwdrxwsxwvpxvwehzlwklq t '464riwkhfurvvlqjsrlqwri/>8@'46[ />8@'46[?'46pxvwdovrpdlqwdlqdplqlpxp+,*+dqg/2:wlphri t 46+dqg t 46/3ulruwrwkh5($'suhdpeohwkh'4edoovzloohlwkhuehiordwlqjru whuplqdwhgghshqglqjrqwkhvwdwxvriwkh2'7vljqdo )ljxuhvkrzvwkhvwurehwrforfnwlplqjgxulqjd5($'7kh furvvlqjsrlqw'46['46[?pxvwwudqvlwlrqzlwk? t '46&.riwkhforfnfurvvlqjsrlqw7kh gdwdrxwkdvqrwlplqjuhodwlrqvklswrforfnrqo\wr'46dvvkrzqlq)ljxuh )ljxuhdovrvkrzvwkh5($'suhdpeohdqgsrvwdpeoh1rupdoo\ erwk'46[dqg'46[?duh+,*+=wrvdyhsrzhu 9 dd 4 3ulruwrgdwdrxwsxwiurpwkh 6'5$0'46[lvgulyhq/2:dqg'46[?gulyhq+,*+iru t 535(7klvlvnqrzqdvwkh5($'suhdpeoh 7kh5($'srvwdpeoh t 5367lvrqhkdoiforfniurpwkhodvw/>8@'46[/>8@'46[?wudqv lwlrq'xulqjwkh5($'srvwdpeoh/>8@'46[lvgulyhq/2:dqg/ >8@ '46[?gulyhq+,*+:khqfrpsohwhwkh'4zloohlwkhuehglvdeohgruzloofrqwlqxhwhuplqdwlqjghshqglqjrqwkhvwdwhriwkh2'7vljqdo)ljxuhghprq - vwudwhvkrzwrphdvxuh t rpst. read
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. the bl8 setting is activated by either mr0[1, 0] = 0, 0 or mr0[0, 1] = 0, 1 and a12 = 1 during read command at t0. 3. do n = data-out from column n. 4. bl8, rl = 5 (al = 0, cl = 5). 5. output timings are referenced to v cc q/2 and dll on and locked. 6. t dqsq defines the skew between dqs, dqs# to data and does not define dqs, dqs# to clock. 7. early data transitions may not always happen at the same dq. data transitions of a dq can vary (either early or late) within a burst. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 bank, col n t rpst nop read nop nop nop nop nop nop nop nop nop ck ck# command 1 add ress 2 t dqsq (max) dqs, dqs# dq 3 (last data valid) dq 3 (first data no lon ger valid) all dq collectively do n do n+ 3 do n + 2 do n+ 1 do n+ 7 do n+ 6 do n+ 5 do n+ 4 do n + 2 do n+ 1 do n+ 7 do n + 6 do n+ 5 do n+ 4 do n+ 3 do n+ 2 do n+ 1 do n do n+ 7 do n+ 6 do n+ 5 do n do n + 3 t rpre don t care transitioning data data valid data valid t qh t qh t hz (dq) max do n+ 4 rl = al + cl t dqsq (max) t lz (dq) min figure 69 - data output timing ? t dqsq and data valid window
logic devices incorporated www.logicdevices.com 118 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t +=dqg t /=wudqvlwlrqvrffxulqwkhvdphdffhvvwlphdvydolggdwdwudqvlwlrqv7khvhsdudphwhuvduhuhihuhqfhgwrdvshflilfyrowdjhohyhozklfkvshflilhv zkhqwkhghylfhrxwsxwlvqrorqjhugulylqj t += '46 dqg t += '4 ruehjlqvgulylqj t /= '46  t /= '4 )ljxuhvkrzvdphwkrgwrfdofxodwhwkhsrlqw zkhqwkhghylfhlvqrworqjhugulylqj t += '46 dqg t += '4 ruehjlqvgulylqj t /= '46  t /= '4 e\phdvxulqjwkhvljqdodwwzrgliihuhqwyrowdjhv7kh  dfwxdoyrowdjhphdvxuhphqwsrlqwv duhqrwfulwlfdodvorqjdvw khfdofxodwlrqlvfrqvlvwhqw7khsdudphwhuv t /= '46  t /= '4  t += '46 dqg t += '4 duh ghilqhgdvvlqjohhqghg output timing
logic devices incorporated www.logicdevices.com 119 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product rl measured to this point dqs, dqs# early strobe ck t dqsck (min) t lz (dqs) min t hz (dqs) min dqs, dqs# late strobe t dqsck (max) t lz (dqs) max t hz (dqs) max t dqsck (min) t dqsck (min) t dqsck (max) t dqsck (max) t dqsck (max) t dqsck (min) ck# t rpre t qsh t qsl t qsl t qsl t qsl t qsh t qsh t qsh bit 0 bit 1 bit 2 bit 7 t rpre bit 0 bit 1 bit 2 bit 7 bit 6 bit 3 bit 4 bit 5 bit 6 bit 4 bit 3 bit 5 t rpst t rpst t0 t1 t2 t3 t4 t5 t 6 figure 70 - data strobe timing ? reads
logic devices incorporated www.logicdevices.com 120 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product notes: 1. within a burst, the rising strobe edge is not necessarily fixed at t dqsck (min) or t dqsck (max). instead, the rising strobe edge can vary between t dqsck (min) and t dqsck (max). 2. the dqs high pulse width is defined by t qsh, and the dqs low pulse width is defined by t qsl. likewise, t lz (dqs) min and t hz (dqs) min are not tied to t dqsck (min) (early strobe case) and t lz (dqs) max and t hz (dqs) max are not tied to t dqsck (max) (late strobe case); however, they tend to track one another. 3. the minimum pulse width of the read preamble is defined by t rpre (min). the minimum pulse width of the read postamble is defined by t rpst (min). t hz (dqs), t hz (dq) t hz (dqs), t hz (dq) end point = 2 t1 - t2 v oh - xmv v tt - xmv v ol + xmv v tt + xmv v oh - 2xmv v tt - 2xmv v ol + 2xmv v tt + 2xmv t lz (dqs), t lz (dq) t lz (dqs), t lz (dq) begin point = 2 t1 - t2 t1 t1 t2 t2 figure 71 - method for calculating t lz and t hz
logic devices incorporated www.logicdevices.com 121 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 72 - t rpre t iming t rpre dqs - dqs# dqs dqs# t1 t rpre begins t2 t rpre ends ck ck # v tt resultin g differential signal relevant for t rpre specification t c t a t b t d 0v v tt v tt single-ended signal, provided as background information single-ended signal, provided as background information f igure 73 - t rpst t iming t rpst dqs - dqs# dqs dqs# t1 t rpst begins t2 t rpst ends resultin g differential signal relevant for t rpst specification ck ck # v tt t c t a t b t d single-ended signal, provided as background information 0v v tt v tt single-ended signal, provided as background information
logic devices incorporated www.logicdevices.com 122 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 74 - t wpre t iming dqs - dqs# t1 t wpre begins t2 t wpre ends t wpre resulting differential signal relevant for t wpre specification 0v ck ck# v tt f igure 75 - t wpst t iming t wpst dqs - dqs# t1 t wpst begins t2 t wpst ends resulting differential signal relevant for t wpst specification 0v ck ck # v tt
logic devices incorporated www.logicdevices.com 123 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product write :5,7(exuvwvduhlqlwldwhgzlwkd:5,7(frppdqg7khvwduwlqj&2/801dqg%$1.dgguhvvhvduhsurylghgzlwkwkh:5,7(frppdqg dqg$87235( - &+$5*(lvvhohfwhgwkh52:ehlqjdffhvvhgzlooeh35(&+$5*('d wwkhhqgri:5,7(exuvw,i$87235(&+$5*(lvqrwvhohfwhgw kh52:zloouhpdlq rshqiruvxevhtxhqwdffhvvhv$iwhud:5,7(frppdqgkdvehhqlvvxhgwkh:5,7(exuvwpd\qrwehlqwhuuxswhg)ruwkhjhqhulf:5,7(frppdqgvxvhg lq)ljxuhwkrxjk)ljxuh$87235(&+$5*(lvglvdeohg 'xulqj:5,7(exuvwvwkhiluvwydolggdwdlqhohphqwlvuhjlvwhuhgrqdulvlqjhgjhri'46[iroorzlqjwkh:5,7(/$7(1&< :/ forfnvodwhudqgvxevhtxhqw gdwdhohphqwvzlooehuhjlvwhuhgrqvxffhvvlyhhgjhvri'46[ :5,7(/$7(1&< :/ lvghilqhgdvwkhvxpri3267('&$6$'',7,9( /$7(1&< $/ dqg &$6:5,7(/$7(1&< &:/ :/ $/&:/7khydoxhvri$/dqg& :/duhsurjudpphglqwkh05dqg05uhjlvwhuvuhvshfwlyho\ 3ulruwrwkhiluvw ydolg'46[hgjhdixoof\fohlvqhhghg lqfoxglqjdgxpp\furvvryhuri'46['46[? dqgvshflilhgdvwkh:5,7(suhdpeohvkrzqlq)ljxuh7khkdoi f\fohrq'46[iroorzlqjwkhodvwgdwdlqhohphqwlvnqrzqdvwkh:5,7(srvwdpeoh 7khwlphehwzhhqwkh:5,7(frppdqgdqgwkhiluvwydolghgjhri '46[lv:/forfnv? t '466)ljxuhwkurxjk)ljxuhvkrzwkhqrplqdofdvhzkhuh t '466 qvkrzhyhu)ljxuhlqfoxghv t '466 0,1 dqg t '466 0$; fdvhv 'dwdpd\ehpdvnhgiurpfrpsohwlqjd:5,7(xvlqjgdwdpdvn7k hpdvnrffxuvrqwkh'0edoodoljqhgwrwkh:5,7(gdwd,i'0lv/2:wkh:5,7( frpsohwhvqrupdoo\,i'0lv+,*+wkdwelwrigdwdlvpdvnhg 8srqfrpsohwlrqridexuvwdvvxplqjqrrwkhufrppdqgvkdyhehhqlqlwldwhgwkh'4zloouhpdlq+,*+=dqgdq\dgglwlrqdolqsxwgdwdzlooehljqruhg 'dwdirudq\:5,7(exuvwpd\ehfrqfdwhqdwhgzlwkdvxevhtxhqw:5,7(frppdqgwrsurylghdfrqwlqxrxviorzrilqsxwgdwd7khqhz:5,7(frppdqg fdqeh t &&'forfnviroorzlqjwkhsuhylrxv:5,7(frppdqg7khiluvwgdw dhohphqwiurpwkhqhzexuvwlvdssolhgdiwhuwkhodvwhohphqwridfrpsohwhgexuvw  )ljxuhvdqgvkrzfrqfdwhqdwhgexuvwv$qh[dpsohriqrqf rqvhfxwlyh:5,7(6lvvkrzqlq)ljxuh 'dwdirudq\:5,7(exuvwpd\ehiroorzhge\dvxevhtxhqw5($'frppdqgdiwhu t :75kdvehhqphw vhh)ljxuhvdqg  'dwdirudq\:5,7(exuvwpd\ehiroorzhge\dvxevhtxhqw35(&+$5*(frppdqgsurylglqj t :5kdvehhqphwdvvkrzqlq)ljxuhdqg)ljxuh both t :75dqg t :5vwduwlqjwlphpd\ydu\ghshqglqjrqwkhprghuhjlvwhuvhwwlqjv il[hg%&%/yv27) 
logic devices incorporated www.logicdevices.com 124 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 76 - w rite b urst notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. the bl8 setting is activated by either mr0[1:0] = 00 or mr0[1:0] = 01 and a12 = 1 during the write command at t0. 3. di n = data-in for column n. 4. bl8, wl = 5 (al = 0, cwl = 5). 5. t dqss must be met at each rising clock edge. 6. t wpst is usually depicted as ending at the crossing of dqs, dqs#; however, t wpst actually ends when dqs no longer drives low and dqs# no longer drives high. di n + 3 di n + 2 di n + 1 di n t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 don t care transitioning data di n + 7 di n + 6 di n + 5 di n + 4 bank, col n nop write nop nop nop nop nop nop nop nop nop ck ck# c ommand 1 dq 3 dqs, dqs# add ress 2 t wpst t wpre t wpst t dqsl dq 3 dq 3 t wpst dqs, dqs# dqs, dqs# t dqsl t wpre t dqss t dqss t dsh t dsh t dsh t dsh t dss t dss t dss t dss t dss t dss t dss t dss t dss t dss t dsh t dsh t dsh t dsh t dqsl t dqsh t dqsl t dqsh t dqsl t dqsh t dqsh t dqsl t dqsl t dqsl t dqsl t dqsh t dqsh t dqsh t dqsh t dqsl t dqsh t dqsl t dqsh t dqsh t dqsl t dqsh t dqsl t dqsh t dqsl t dqsh t dqsh wl = al + cwl t dqss (min) t dqss (nom) t dqss (max) t dqsl t wpre di n + 3 di n + 2 di n + 1 di n di n + 7 di n + 6 di n + 5 di n + 4 di n + 3 di n + 2 di n + 1 di n di n + 7 di n + 6 di n + 5 di n + 4
logic devices incorporated www.logicdevices.com 125 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 77 - c onsecutive write (bl8) to write (bl8) notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. the bl8 setting is activated by either mr0[1:0] = 00 or mr0[1:0] = 01 and a12 = 1 during the write commands at t0 and t4. 3. di n (or b) = data-in for column n (or column b). 4. bl8, wl = 5 (al = 0, cwl = 5). wl = 5 wl = 5 t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t ccd t wpre t10 t11 don t care transitioning data t12 t13 t14 valid valid nop write write nop nop nop nop nop nop nop nop nop nop nop nop ck ck# command 1 dq 3 dqs, dqs# add ress 2 t wpst t wr t wtr t bl = 4 clocks di n + 3 di n + 2 di n + 1 di n di n + 7 di n + 6 di n + 5 di n + 4 di b + 3 di b + 2 di b + 1 di b di b + 7 di b + 6 di b + 5 di b + 4 f igure 78 - c onsecutive write (bc4) to write (bc4) via mrs or otf notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. bc4, wl = 5 (al = 0, cwl = 5). 3. di n (or b) = data-in for column n (or column b). 4. the bc4 setting is activated by mr0[1:0] = 01 and a12 = 0 during the write command at t0 and t4. wl = 5 wl = 5 t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t ccd t wpre t10 t11 don t care transitioning data t12 t13 t14 vali d vali d nop write write nop nop nop nop nop nop nop nop nop nop nop nop ck ck# command 1 dq 3 dqs, dqs# address 2 t wpst t wr t wtr t wpst t wpre di n + 3 di n + 2 di n + 1 di n di b + 3 di b + 2 di b + 1 di b t bl = 4 clo cks
logic devices incorporated www.logicdevices.com 126 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 79 - n onconsecutive write to write notes: 1. di n (or b) = data-in for column n (or column b). 2. seven subsequent elements of data-in are applied in the programmed order following do n. 3. each write command may be to any bank. 4. shown for wl = 7 (cwl = 7, al = 0). ck ck# c ommand nop nop nop add ress dq dm dqs, dqs# transitioning data nop nop nop nop nop nop nop nop nop nop t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 t12 t13 t14 t15 t16 t17 nop write nop write vali d vali d nop di n di n + 1 di n + 2 di n + 3 di n + 4 di n + 5 di n + 6 don't care di n + 7 di b di b + 1 di b + 2 di b + 3 di b + 4 di b + 5 di b + 6 di b + 7 wl = c wl + al = 7 wl = c wl + al = 7 f igure 80 - write (bl8) to read (bl8) notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. t wtr controls the write-to-read delay to the same device and starts with the first rising clock edge after the last write data shown at t9. 3. the bl8 setting is activated by either mr0[1:0] = 00 or mr0[1:0] = 01 and mr0[12] = 1 during the write command at t0. the read command at ta0 can be either bc4 or bl8, depending on mr0[1:0] and the a12 status at ta0. 4. di n = data-in for column n. 5. rl = 5 (al = 0, cl = 5), wl = 5 (al = 0, cwl = 5). wl = 5 t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t wpre t10 t11 don t care transitioning data ta0 nop write read vali d vali d nop nop nop nop nop nop nop nop nop nop ck ck# command 1 dq 4 dqs, dqs# add ress 3 t wpst t wtr 2 indicates a break in time scale di n + 3 di n + 2 di n + 1 di n di n + 7 di n + 6 di n + 5 di n + 4
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 81 - write to read (bc4 m ode r egister s etting ) notes: 1. nop commands are shown for ease of illustrati on; other commands may be valid at these times. 2. t wtr controls the write-to-read delay to the same device and starts with the first rising clock edge after the last write data shown at t7. 3. the fixed bc4 setting is activated by mr0[1:0] = 10 during the write command at t0 and the read command at ta0. 4. di n = data-in for column n. 5. bc4 (fixed), wl = 5 (al = 0, cwl = 5), rl = 5 (al = 0, cl = 5). wl = 5 t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 ta0 don t care transitioning data nop write vali d read vali d pon pon pon pon pon pon pon nop ck ck# command 1 dq 4 dqs, dqs# add ress 3 t wpst t wtr 2 t wpre indicates a break in time scale di n + 3 di n + 2 di n + 1 di n
logic devices incorporated www.logicdevices.com 128 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 82 - write (bc4 otf) to read (bc4 otf) notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. t wtr controls the write-to -read delay to the same device and starts after t bl. 3. the bc4 otf setting is activated by mr0[1:0] = 01 and a 12 = 0 during the write command at t0 and the read command at tn. 4. di n = data-in for column n. 5. bc4, rl = 5 (al = 0, cl = 5), wl = 5 (al = 0, cwl = 5). wl = 5 rl = 5 t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t wpre t10 t11 don t care transitioning data tn nop write read vali d vali d nop nop nop nop nop nop nop nop nop ck ck# c ommand 1 dq 4 dqs, dqs# add ress 3 t wpst t bl = 4 clo cks nop t wtr 2 indicates a break in time scale di n + 3 di n + 2 di n + 1 di n
logic devices incorporated www.logicdevices.com 129 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 83 - write (bl8) to precharge notes: 1. di n = data-in from column n. 2. seven subsequent elements of data-in are applie d in the programmed order following do n. 3. shown for wl = 7 (al = 0, cwl = 7). t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 t12 ta0 ta1 di n + 3 di n + 2 di n + 1 di n di n + 6 di n + 7 di n + 5 di n + 4 nop write vali d nop nop nop nop nop nop nop nop nop nop nop nop pre ck ck # c ommand dq bl8 dqs, dqs# add ress don t care transitioning data indicates a break in time scale t wr wl = al + cwl vali d f igure 84 - write (bc4 m ode r egister s etting ) to precharge notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. the write recovery time ( t wr) is referenced from the first rising clock edge after the last write data is shown at t7. t wr specifies the last burst write cycle until the precharge command can be issued to the same bank. 3. the fixed bc4 setting is activated by mr0[ 1:0] = 10 during the write command at t0. 4. di n = data-in for column n. 5. bc4 (fixed), wl = 5, rl = 5. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 t12 ta0 ta1 di n + 3 di n + 2 di n + 1 di n nop write vali d nop nop nop nop nop nop nop nop nop nop nop nop pre ck ck # comman d dq bc4 dqs, dqs# add ress don t care transitioning data indicates a break in time scale t wr wl = al + cwl vali d
logic devices incorporated www.logicdevices.com 130 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 85 - write (bc4 otf) to precharge notes: 1. nop commands are shown for ease of illustration; other commands may be valid at these times. 2. the write recovery time ( t wr) is referenced from the rising clock edge at t9. t wr specifies the last burst write cycle until the precharge command can be issued to the same bank. 3. the bc4 setting is activated by mr0[1:0] = 01 and a12 = 0 during the write command at t0. 4. di n = data-in for column n. 5. bc4 (otf), wl = 5, rl = 5. wl = 5 t0 t1 t2 t3 t4 t 5 t6 t 7 t8 t9 t n don t care transitioning data bank, col n nop write pre nop nop nop nop nop nop nop nop ck ck# command 1 dq 4 dqs, dqs # add ress 3 t wpst t wpre indicates a break in time scale di n + 3 di n + 2 di n + 1 di n t wr 2 valid dq input timing f igure 86 - d ata i nput t iming t dh t ds dm dq di b dq s, dqs# don t care transitioning data t dqsh t dqsl t wpre t wpst phpru\frqwuroohudiwhuwkhodvwgdwdlvzulwwhqwrwkh6'5$0gxulqjwkh :5,7(srvwdpeoh t :367 'dwdvhwxsdqgkrogwlphvduhvkrzqlq)ljxuh$oovhwxsdqgkrogwlphv duhphdvxuhgiurpwkhfurvvlqjsrlqwvri'46[dqg'46[?7khvhvhwxs dqgkrogydoxhvshuwdlqwrgdwdlqsxwdqggdwdpdvnlqsxw $gglwlrqdoo\wkhkdoishulrgriwkhgdwdlqsxwvwurehlvvshflilhge\ t '46+ and t dqsl. )ljxuhvkrzvwkhvwurehwrforfnwlplqjgxulqjd:5,7('46 ['46[? pxvwwudqvlwlrqzlwklq t &.riwkhforfnwudqvlwlrqvdvolplwhge\ t dqss. $oogdwddqggdwdpdvnvhwxsdqgkrogwlplqjvduhphdvxuhguhodwlyhwrwkh '46['46[?furvvlqjvqrwwkhforfnfurvvlqj 7kh:5,7(suhdpeohdqgsrvwdpeohduhdovrvkrzq2qhforfnsul ruwr gdwdlqsxwwrwkh6'5$0'46[pxvweh+,*+dqg'46[?pxvweh/2 :  7khqirudkdoiforfn'46[lvgulyhq/2: '46[?lvgulyhq+,*+ gxulqj wkh:5,7(suhdpeoh t :35(olnhzlvh'46[pxvwehnhsw/2:e\wkh
logic devices incorporated www.logicdevices.com 131 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product precharge ,qsxw$ghwhuplqhvzkhwkhurqhedqnrudooedqnv duhwreh35(&+$5*('dqglqwkhfdvhzkhuhrqo\rqhedqnlvwrehsuhfkdujh glqsxwv%$>@vhohfw wkhduud\%$1. :khqdooedqnvduhwreh35(&+$5*('lqsxwv%$>@duhwuhdwhgdvv'rquw&duhw$iwhudedqnlv35(&+$5*('lwlvlqwkh,'/(6wdwhdqgpxvweh $&7,9$7('sulruwrdq\5($'ru:5,7(frppdqgvehlqjlvvxhg self refresh 7kh6(/)5()5(6+frppdqglvlqlwldwhgolnhd5()5(6+frppdqgh[fhsw&.(lv/2:7kh'//lvdxwrpdwlfdoo\glvdeohgxsrqhqwhul qj6(/)5()5(6+ dqglvdxwrpdwlfdoo\hqdeohgdqguhvhwxsrqh[lwlqj6(/)5()5(6+$oosrzhuvxsso\lqsxwv lqfoxglqj9 5()&$ dqg9 5()'4 pxvwehpdlqwdlqhgdwydolg ohyhovxsrqhqwu\h[lwdqggxulqj6(/)5()5(6+prghrshudwlrq 9 5()'4 pd\iordwruqrwgulyh9 dd 4zklohlqwkh6(/)5()5(6+prghxqghufhuwdlq frqglwlrqv x9vv9 5()'4 9 dd lvpdlqwdlqhg x9 5()'4 lvydolgdqgvwdeohsulruwr&.(jrlqjedfn+,*+ x7khiluvw:5,7(rshudwlrqpd\qrwrffxuhduolhuwkdqforfnvdiwhu9 5()'4 is valid x$oorwkhu6(/)5()5(6+prghh[lwwlplqjuhtxluhphqwvduhphw 7kh6'5$0pxvwehlgohzlwkdoo%$1.6lqwkh35(&+$5*(vwdwh t 53lvvdwlvilhgdqgqrexuvwvduhlqsurjuhvv ehiruhd6(/)5()5(6+hqwu\frppdqg fdqehlvvxhg2'7pxvwdovrehwxuqhgriiehiruh6(/)5()5(6+hqwu\e\uhjlvwhulqjwkh2'7edoo/2:sulruwrwkh6(/)5()5(6+hqwu\frppdqg vhh v2q'lh7huplqdwlrq 2'7 iruwlplqjuhtxluhphqwv ,i5 tt _nom and r tt b:5duhglvdeohglqwkhprghuhjlvwhuv2'7fdqehdv'rquw&du hw$iwhuwkh6(/) 5()5(6+hqwu\frppdqglvuhjlvwhuhg&.(pxvwehkhog/2:wrnhhswkh6'5$0lq6(/)5()5(6+prgh $iwhuwkh6'5$0kdvhqwhuhg6(/)5()5(6+prghdooh[whuqdofrqwurovljqdovh[fhsw&.(dqg5(6(7?ehfrphv'rquw&duhw7kh 6'5$0lqlwldwhvd plqlpxprirqh5()5(6+frppdqglqwhuqdoo\zlwklqwkh t &.(shulrgzkhqlwhqwhuv6(/)5()5(6+prgh 7khuhtxluhphqwviruhqwhulqjdqgh[lwlqj6(/)5()5(6+prghghshqgrqwkhvwdwhriwkhforfngxulqj6(/)5()5(6+prgh)luvwdqgiruhprvwwkhforfn pxvwehvwdeoh phhwlqj t &.vshflilfdwlrqv zkhq6(/)5()5(6+prghlvhqwhuhg,iwkhforfnuhpdlqvvwdeohdqgwkhiuhtxhqf\lqqrwdowhuhgzklohlq6 (/) 5()5(6+prghwkhqwkh6'5$0lvdoorzhgwrh[lw6(/)5()5(6+di whu t &.(65lvvdwlvilhg &.(lvdoorzhgwrwudqvlwlrq+,*+ t &.(65odwhuwkdqzkhq &.(zdvuhjlvwhuhg/2: 6lqfhwkhforfnuhpdlqvvwdeohlq6(/)5()5(6+prgh qriuhtxhqf\fkdqjh  t &.65(dqg t &.65;duhqrwuhtxluhg+rzhyhu liwkhforfnlvdowhuhggxulqj6(/)5()5(6+prghwkhq t &.65(dqg t &.65;pxvwehvdwlvilhg:khqhqwhulqj6(/)5()5(6+ t &.65(pxvwehvdwlvilhg sulruwrdowhulqjwkhforfnuviuhtxhqf\3ulruwrh[lwlqj6(/)5()5(6+ t &.65;pxvwehvdwlvilhgsulruwruhjlvwhulqj&.(+,*+ :khq&.(lv+,*+gxulqj6(/)5()5(6+h[lw123ru'(6pxvwehl vvxhgiru t ;6wlph t ;6lvuhtxluhgiruwkhfrpsohwlrqridq\lqwhuqdo5()5(6+wkdw lvdouhdg\lqsurjuhvvdqgpxvwehvdwlvilhgehiruhdydolgfrppdqgqrwuhtxlulqjdorfnhg'//fdqehlvvxhgwrwkhghylfh t ;6lvdovrwkhhduolhvwwlphwkdwd 6(/)5()5(6+uhhqwu\pd\rffxu vhh)ljxuh %hiruhdfrppdqguhtxlulqjdorfnhg'//fdqehdssolhgd=4&/frppdqgpxvwehlvvxhg t =423(5 wlplqjpxvwehphwdqg t ;6'//pxvwehvdwlvilhg2'7pxvwehriigxulqj t ;6'//
logic devices incorporated www.logicdevices.com 132 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 87 - s elf r efresh e ntry /e xit t iming notes: 1. the clock must be valid and stable meeting t ck specifications at least t cksre after entering self refresh mode, and at least t cksrx prior to exiting self refresh mode, if the clock is stopped or altered between states ta0 and tb0. if the clock remains valid and unchanged from entry and during self refresh mode, then t cksre and t cksrx do not apply; however, t ckesr must be satisfied prior to exiting at srx. 2. odt must be disabled and r tt off prior to entering self re fresh at state t1. if both r tt _ nom and r tt _ wr are disabled in the mode registers, odt can be a dont care. 3. self refresh entry (sre) is synchronous via a refresh command with cke low. 4. a nop or des command is required at t2 after the sre command is issued prior to the inputs becoming dont care. 5. nop or des commands are required prior to exiting self refresh mode until state te0. 6. t xs is required before any commands not requiring a locked dll. 7. t xsdll is required before any commands requiring a locked dll. 8. the device must be in the all banks idle state prior to entering self refresh mode. for exam- ple, all banks must be precharged, t rp must be met, and no data bursts can be in progress. 9. self refresh exit is asynchronous; however, t xs and t xsdll timings start at the first rising clock edge where cke high satisfies t isxr at tc1. t cksrx timing is also measured so that t isxr is satisfied at tc1. ck ck # command nop nop 4 sre(ref) 3 add ress ck e odt 2 reset# 2 vali d vali d 6 srx (nop) nop 5 t rp 8 t xs 6 , 9 t xs dll 7, 9 odtl t is t cpded t is t is enter self refresh mode (synchronous) exit self refresh mode (asynchronous) t0 t1 t2 tc 0 tc1 td0 tb 0 don t care te0 vali d vali d 7 vali d vali d vali d t ih ta0 tf0 indicates a break in time scale t cksrx 1 t cksre 1 t ckesr (min) 1
logic devices incorporated www.logicdevices.com 133 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 6hoi5hiuhvk7hpshudwxuh 657 extended temperature usage /2*,&'hylfhv,qfl02'''56'5$0prgxohvxssruwvwkhrswlrqdoh[whqghgwhpshudwxuhudqjhxswr d ?&zklohvxssruwlqj6(/)5()5(6+$872 5()5(6+dqgvxssruw7 $ whpshudwxuhv!?& d ?&zlwk0$18$/5()5(6+rqo\:khqxvlqj6(/)5()5(6+$8725 ()5(6+dqgwkhdpelhqw whpshudwxuhlv!?&657dqg$65rswlrqvpxvwehxvhg 7khh[whqghgudqjhwhpshudwxuhudqjh6'5$0pxvweh5()5(6+('h[whuqdoo\dw;dq\wlphwkhdpelhqwwhpshudwxuhlv!?&7khh [whuqdo5()5(6+- ,1*uhtxluhphqwlvdffrpsolvkhge\uhgxflqjwkh5()5(6+3(5,2'iurppvwrpv6(/)5()5(6+prghuhtxluhvwkhxvhri$65r u657wrvxssruw wkhh[whqghgwhpshudwxuh field mr2 bits description srt asr t able 63: self refresh t emperature and auto self refresh d escription ,i$65lvglvdeohg 05>@  657pxvwehsurjudpphgwrlqglfdwh t 23(5gxulqj6(/)5()5(6+ 05>@ 1rupdorshudwlqjwhpshudwxuhudqjh ?&wr d 85?& 05>@ ([whqghgrshudwlqjwhpshudwxuhudqjh !?&wr d 105?& ,i$65lvhqdeohg 05>@  657pxvwehvhwwrhyhqliwkhh[whqghgwhpshudwxuhudqjhlvvxssruwhg 05>@ 657lvglvdeohg :khq$65lvhqdeohgwkh6'5$0dxwrpdwlfdoo\surylghv6(/)5()5(6+srzhupdqdjhphqwixqfwlrqv uhiuhvkudwh irudoovxssruwhgrshudwlqjwhpshudwxuhydoxhv 05>@ $65lvhqdeohg 0pxvw  :khq$65lvqrwhqdeohgwkh657elwpxvwehsurjudpphgwrlqglfdwh t 23(5gxulqj6(/)5()5(6+rshudwlrq 05>@ $65lvglvdeohgpxvwxvhpdqxdo6(/)5()5(6+ 657  6 $xwr6hoi5hiuhvk $65 self refresh operation 0 0 1 1 t able 64: self refresh m ode s ummary 6(/)5()5(6+0rghlvvxssruwhglqwkhqrupdowhpshudwxuhudqjh 6(/)5()5(6+0rghlvvxssruwhglqqrupdodqgh[whqghg d 95?&0$;  whpshudwxuhudqjhv:khq657lvhqdeohglwlqfuhdvhvvhoiuhiuhvksrzhu frqvxpswlrq 6hoiuhiuhvkprghlvvxssruwhglqqrupdodqgh[whqghgwhpshudwx uhudqjhv 6hoiuhiuhvksrzhufrqvxpswlrqpd\ehwhpshudwxuhghshqghqw illegal. 0 1 0 1 permitted operating temperature range for self refresh mode mr2[7] (srt) mr2[6] (asr) 1rupdo ?&wr?&  1rupdodqgh[whqghg ?&wr?& 1rupdodqgh[whqghg ?&wr?& power-down mode 3rzhugrzqlvv\qfkurqrxvo\hqwhuhgzkhq&.(lvuhjlvwhuhg/2:frlqflghqwzlwkd123ru'(6frppdqg&.(lvqrwdoorzhgwrjr/2:zklohhlwkhudq 056035=4&$/5($'ru:5,7(rshudwlrqlvlqsurjuhvv&.(l vdoorzhgwrjr/2:zklohdq\riwkhrwkhuohjdorshudwlrqvduhlqsurjuhvv+rzhyhuwkh 32:(5'2:1, dd vshflilfdwlrqvduhqrwdssolfdeohxqwlovxfkrshudwlrqvkdyhehhqfrpsohwhg'hshqglqjrqwkhsuhylrxv6'5$0vwdwhdqgwkhfrppdqg lvvxhgsulruwr&.(jrlqj/2:fhuwdlqwlplqjfrqvwudlqwvpxvwehvdwlvilhg dvqrwhglq7deoh 7lplqjgldjudpvghwdlolqj wkhgliihuhqw32:(5'2:1 prghhqwu\dqgh[lwvduhvkrzqlq)ljxuhwkurxjk)ljxuh
logic devices incorporated www.logicdevices.com 134 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product idle or active idle or active active active active active active idle power-down idle t able 65: command to power-down e ntry p arameters t $&73'(1 t 353'(1 t 5'3'(1 t :53'(1 t :5$3'(1 t 5()3'(1 t ;3'// t 0563'(1 $&7,9$7( 35(&+$5*( 5($'ru5($'$3 :5,7(%/27)%/056%&27) :5,7(%&056 :5,7($3%/27)%/056%&27) :5,7($3%&056 5()5(6+ 5()5(6+ 02'(5(*,67(56(7 last command prior to cke low 1 1 t &. 1 t &. rl = 4 t &. t &. :/ t &. t :5 t &. :/ t &. t :5 t &. :/ t &.:5 t &. :/ t &.:5 t &. 1 t &. *uhdwhuri t &.ruqv t mod figure 95 figure 96 figure 91 figure 92 figure 92 figure 93 figure 93 figure 94 figure 98 )ljxuh sdram status parameter (min) parameter value figure (qwhulqj32:(5'2:1prghglvdeohvwkhlqsxwdqgrxwsxwexiihuvh[foxglqj&.&.?2'7&.(dqg5(6(7?123ru'(6frppdqgvd uhuhtxluhgxqwlo t &3'('kdvehhqvdwlvilhgdwzklfkwlphdoovshflilhglqsxwrxwsxwexiihuvzlooehglvdeohg7kh'//vkrxogehlqdorfnhgvw dwhzkhq32:(5'2:1lv hqwhuhgiruwkhidvwhvwprghwlplqj,iwkh'//lvqrworfnhggxulqjwkh32:(5'2:1hqwu\wkh'//pxvwehuhvhwdiwhuh[lwlq j32:(5'2:1irusurshu 5($'rshudwlrqdvzhoodvv\qfkurqrxv2'7rshudwlrq 'xulqj32:(5'2:1hqwu\lidq\edqnuhpdlqvrshqdiwhudoolqsurjuhvvfrppdqgvduhfrpsohwhwkh6'5$0zlooehlq$&7,9(32: (5'2:1,idoo edqnvduhforvhgdiwhudoolqsurjuhvvfrppdqgvduhfrpsohwhwkh6'5$0zlooehlq35(&+$5*(32:(5'2:1prghruidvw(;,7prgh:khqhqwhulqj 35(&+$5*(32:(5'2:1wkh'//lvwxuqhgriilqvorzh[lwprghrunhswrqlqidvw(;,7prgh 7kh'//uhpdlqvrqzkhqhqwhulqj$&7,9(32:(5'2:1dvzhoo2'7kdvvshfldowlplqjfrqvwudlqwvzkhqvorz(;,7prgh35(&+$5*( 32:(5 '2:1lvhqdeohgdqghqwhuhg5hihuwrv$v\qfkurqrxv2'70rghwirughwdlohg2'7xvdjhuhtxluhphqwvlqvorz(;,7prgh35(&+$5*( 32:(5'2:1 $vxppdu\riwkhwzr32:(5'2:1prghvlvolvwhglq7deoh :klohlqhlwkhu32:(5'2:1vwdwh&.(lvkhog/2:5(6(7?lvkh og+,*+dqgdvwdeohforfnvljqdopxvwehpdlqwdlqhg2'7pxvwehlqdydolgvwdwhexw doorwkhulqsxwvljqdovduhdv'rquw&duhw,i5(6(7?jrhv/2: gxulqj32:(5'2:1wkh6'5$0zloovzlwfkrxwri32:(5'2:1dqg jrlqwrwkh5(6(7 vwdwh$iwhu&.(lvuhjlvwhuhg/2:&.(pxvwuhpdlq/2:xqwlo t 3' 0,1 kdvehhqvdwlvilhg7khpd[lpxpwlphdoorzhgiru32:( 5'2:1gxudwlrqlv t 3' 0$;  [w5(),  7kh32:(5'2:1vwdwhvduhv\qfkurqrxvo\h[lwhgzkhq&.(lvuhjl vwhuhg+,*+ zlwkduhtxluhg123ru'(6frppdqg &.(pxvweh pdlqwdlqhg+,*+ until t &.(kdvehhqvdwlvilhg$ydolgh[hfxwdeohfrppdqgpd\ehdss olhgdiwhu32:(5'2:1(;,7/$7(1&< t ;3 t ;3'//kdyhehhqvdwlvilhg$vxp - pdu\riwkh32:(5'2:1prghvlvolvwhglq7deoh d l l s t a t e $&7,9( dq\edqnrshq 35(&+$5*( dooedqnv35(&+$5*(' t able 66: power-down m odes on on off relevant parameters mr1[12] t ;3wrdq\rwkhuydolg&200$1' t ;3wrdq\rwkhuydolg&200$1' t ;'//wr&200$1'6wkdwuhtxluhwkh'// wrehorfnhg 5($'5'$32'721  t ;3wrdq\rwkhuydolg&200$1' sdram state v'rquw&duhw 1 0 )$67 )$67 6/2: power-down exit
logic devices incorporated www.logicdevices.com 135 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 88 - a ctive p ower -d own e ntry and e xit ck ck# command nop nop nop nop address cke t ck t ch t cl enter power-down mode exit power-down mode dont care valid valid valid t cpded valid t is t ih t ih t is t0 t1 t2 ta0 ta1 ta2 ta3 ta4 nop t xp t cke (min) indicates a break in time scale t pd f igure 89 - p recharge p ower -d own (f ast -e xit m ode ) e ntry and e xit tckemin tckemin ck ck# pon pon pon pon dnammoc cke t ck t ch t cl enter power-down mode exit power-down mode t pd valid t cpded t is t ih t is t0 t1 t2 t3 t4 t5 ta0 ta1 nop dont care indicates a break in time scale t cke (min) t xp
logic devices incorporated www.logicdevices.com 136 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 90 - p recharge p ower -d own (s low -e xit m ode ) e ntry and e xit notes: 1. any valid command not requiring a locked dll. 2. any valid command requiring a locked dll. ck ck# command pon pon pon cke t ck t ch t cl enter power-down mode exit power-down mode t pd valid 2 valid 1 pre t xpdll t cpded t is t ih t is t0 t1 t2 t3 t4 ta ta1 tb nop dont care indicates a break in time scale t xp t cke (min) f igure 91 - p ower -d own e ntry a fter read or read with a uto p recharge (rdap) t0 t1 ta0 ta1 ta2 ta3 ta4 ta5 ta6 ta7 ta8 ta9 don t care transitioning data ta10 ta11 ta12 nop vali d read/ rdap nop nop nop nop nop nop nop nop nop ck ck # c ommand dq bl8 dq bc4 dqs, dqs# add ress ck e t cpded t is t pd power- down or self refresh entry indicates a break in time scale t rdpden di n + 3 di n + 1 di n + 2 di n rl = al + cl di n + 3 di n + 2 di n + 1 di n di n + 6 di n + 7 di n+ 5 di n + 4
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 92 - p ower -d own e ntry a fter write notes: 1. cke can go low 2 t ck earlier if bc4mrs. t0 t1 ta0 ta1 ta2 ta3 ta4 ta5 ta6 ta7 tb 0 tb 1 tb 2 tb 3 tb 4 nop write valid nop nop nop nop nop nop nop nop nop nop nop ck ck # command dq bl8 dq bc4 dqs, dqs# add ress ck e t cpded power- down or self refresh entry 1 don t care transitioning data t wrpden di n + 3 di n + 1 di n + 2 di n t pd indicates a break in time scale di n + 3 di n + 2 di n + 1 di n di n + 6 di n + 7 di n + 5 di n+ 4 t is wl = al + cwl t wr f igure 93 - p ower -d own e ntry a fter write with a uto p recharge (wrap) notes: 1. t wr is programmed through mr0[11:9] and represents t wr (min)ns/ t ck rounded up to the next integer t ck. 2. cke can go low 2 t ck earlier if bc4mrs. t0 t1 ta0 ta1 ta2 ta3 ta4 ta5 ta 6 ta7 tb 0 tb 1 don t care transitioning data tb 2 tb 3 tb 4 nop wrap vali d nop nop nop ck ck# command dq bl8 dq bc4 dqs, dqs# add ress a10 cke t pd t wrapden power- down or self refresh entry 2 start internal pre char ge t cpded t is indicates a break in time scale di n + 3 di n + 2 di n + 1 di n di n + 6 di n + 7 di n + 5 di n + 4 di n + 3 di n + 2 di n + 1 di n wr 1 wl = al + cwl nop nop nop nop nop nop nop nop
logic devices incorporated www.logicdevices.com 138 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 94 - refresh to p ower -d own e ntry notes: 1. after cke goes high during t rfc, cke must remain high until t rfc is satisfied. ck ck# command refresh nop nop nop nop valid cke t ck t ch t cl t cpded t refpden t is t0 t1 t2 t3 ta0 ta1 ta2 tb0 t xp (min) t rfc (min) 1 dont care indicates a break in time scale t cke (min) t pd f igure 95 - activate to p ower -d own e ntry tcke ck ck# command address active nop nop cke t ck t ch t cl dont care t cpded t actpden valid t is t0 t1 t2 t3 t4 t5 t6 t7 t pd
logic devices incorporated www.logicdevices.com 139 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 96 - precharge to p ower -d own e ntry ck ck# command address cke t ck t ch t cl dont care t cpded t prepden t is t0 t1 t2 t3 t4 t5 t6 t7 t pd all/single bank pre nop nop f igure 97 - mrs c ommand to p ower -d own e ntry ck ck# cke t ck t ch t cl t cpded address t is t0 t1 t2 ta0 ta1 ta2 ta3 ta4 t pd dont care indicates a break in time scale valid command mrs nop nop nop nop nop t mrspden
logic devices incorporated www.logicdevices.com 140 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 98 - p ower -d own e xit to r efresh to p ower -d own e ntry notes: 1. t xp must be satisfied before issuing the command. 2. t xpdll must be satisfied (referenced to the registration of power-down exit) before the next power-down can be entered. ck ck# cke t ck t ch t cl enter power-down mode enter power-down mode exit power-down mode t pd t cpded t is t ih t is t0 t1 t2 t3 t4 ta0 ta1 tb0 dont care indicates a break in time scale command nop nop nop nop refresh nop nop t xp 1 t xpdll 2 reset 7kh5(6(7vljqdo 5(6(7? lvdqdv\qfkurqrxvvljqdowkdwwuljjhuvdq\wlphlwgursv/2:dqgwkhuhduhqruhvwulfwlrqvderxwzk hqlwfdqjr/2:$iwhu 5(6(7?lvgulyhq/2:lwpxvwuhpdlq/2:iruqv'xulqjwkl vwlphwkhrxwsxwvduhglvdeohg2'7 5 tt wxuqvrii +,*+= dqgwkh''56'5$0uhvhwv lwvhoi&.(vkrxogeheurxjkw/2:sulruwr5(6(7?ehlqjgulyhq +,*+$iwhu5(6(7?jrhv+,*+wkh6'5$0pxvwehuhlqlwldol]h gdvwkrxjkdqrupdo srzhuxszhuhh[hfxwhg vhh)ljxuh $oouhiuhvkfrxqwhuvrqwkh6'5$0duh5(6(7dqggdwdvwruhglqwkh6'5$0lvdvvxphgx qnqrzqdiwhu5(6(7? kdvehhqgulyhq/2:
logic devices incorporated www.logicdevices.com 141 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 99 - reset s equence cke r tt ba[2:0] all voltage supplies valid and stable high-z dm dqs high-z add ress a10 ck ck# t cl command nop t0 ta0 don t care t cl t is odt dq high-z tb 0 t dllk mr1 with dll enable mrs mrs ba0 = h ba1 = l ba2 = l ba0 = l ba1 = l ba2 = l code code code code vali d vali d vali d vali d normal operation mr2 mr3 mrs mrs ba0 = l ba1 = h ba2 = l ba0 = h ba1 = h ba2 = l code code code code tc0 td0 reset# sta ble an d vali d clo ck vali d vali d dram rea dy for external commands t1 t zq init a10 = h zq cl t is t ioz vali d vali d vali d system reset (warm boot) zq cal mr0 with dll reset t=10ns (min) t = 100ns (min) indicates a break in time scale t = 500s (min) t xpr t mrd t mrd t mrd t mod t (min) = max (10ns, 5 t ck) t ck
logic devices incorporated www.logicdevices.com 142 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product on-die termination (odt) 2'7lvdihdwxuhwkdwhqdeohvwkh6'5$0wrhqdeohglvdeohrqglhwhuplqd - wlrquhvlvwdqfhiruhdfk'4/'46[/'46[?8'46[8'46[?/'0[ dqg 8'0[iruwkhirxuzrugvfrqwdlqhglq/',uv''5l02' 7kh 2'7 ihdwxuh lv ghvljqhg wr lpsuryh vljqdo lqwhjulw\ ri wkh phpru\ duud\vxev\vwhp e\ hqdeolqj wkh ''5 phpru\ frqwuroohu wr lqgh shq - ghqwo\ wxuq rq ru rii wkh 6'5$06 lqwhuqdo whuplqdwlrq uhvlvwdqfh iru dq\ jurxslqjri6'5$0ghylfhv7kh2'7ihdwxuhlvqrwvxssruwhggx ulqj'// glvdeohprgh$vlpsohixqfwlrqdouhsuhvhqwdwlrqriwkh6'5$0 2'7ihd - wxuhlvvkrzqlq)ljxuh7khvzlwfklvhqdeohge\wkhlqwhuqdo2'7frq - wuroorjlfzklfkxvhvwkhh[whuqdo2'7edoodqgrwkhufrqwurolqirupdwlrq functional representation of odt 7khydoxhri5 tt  2'7whuplqdwlrqydoxh lvghwhuplqhge\wkhvhwwlqjvri vhyhudoprghuhjlvwhuelwv vhh7deoh 7kh2'7edoolvljq ruhgzkloh lq 6(/) 5()5(6+ prgh pxvw eh wxuqhg rii sulru wr 6(/) 5()5(6+ hqwu\ ruliprghuhjlvwhuv05dqg05duhsurjudpphgwrglvde oh2'7 2'7lvfrpsulvhgriqrplqdo2'7dqgg\qdplf2'7prghvdqghlwk huri wkhvhfdqixqfwlrqlqv\qfkurqrxvrudv\qfkurqrxvprghv zkhqw kh'// lvriigxulqj35(&+$5*(32:(5'2:1ruzkhqwkh'//lvv\qfkurql ] - lqj   1rplqdo 2'7 lv wkh edvh whuplqdwlrq dqg lv xvhg lq dq\ d oorzdeoh 2'7vwdwh'\qdplf2'7lvdssolhgrqo\gxulqj:5,7(vdqgsuryl ghv27) vzlwfklqjiurpqr5 tt or r tt _nom to r tt b:5 7kh dfwxdo hiihfwlyh whuplqdwlrq 5 tt b()) pd\ eh gliihuhqw iurp wkh 5 tt wdujhwhggxhwrqrqolqhdulw\riwkhwhuplqdwlrq)ru5 tt b())ydoxhvdqg fdofxodwlrqvvhhv2'7&kdudfwhulvwlfvw odt v dd q/2 r tt switch dq, dqs, dqs#, to other circuitry such as rcv, . . . dm f igure 100 - o n -d ie t ermination nominal odt 2'7 120  lv wkh edvh whuplqdwlrq uhvlvwdqfh iru hdfk dssolfdeoh edoo hqdeohgruglvdeohgyld05>@ vhh)ljxuh dqglwlvw xuqhgrqru riiyldwkh2'7edoo t able 67: power-down m odes mr1[9,6,2] odt pin sdram termination state sdram state n o t e s r tt b120glvdeohg2'72)) r tt b120glvdeohg2'721 r tt b120hqdeohg2'72)) r tt b120hqdeohg2'721 r tt _nom reserved, odt on or off $q\ydolg $q\ydolgh[fhsw6(/)5()5(6+5($' $q\ydolg $q\ydolgh[fhsw6(/)5()5(6+5($' illegal 1,2 1,3 1,2 1,3 000 000 000-101 000-101 110 and 111 0 1 0 1 ; 3. 2'7pxvwehglvdeohggxulqj5($'v7kh r tt b120ydoxhlvuhvwulfwhg gxulqj:5,7(6'\qdplf2'7lvdssolfdeohlihqdeohg 127(6 1. $vvxphvg\qdplf2'7lvglvdeohg 2. 2'7lvhqdeohgdqgdfwlyhgxulqjprvw:5,7(6irusurshuwhuplqd wlrq exwlwlvqrwloohjdowrkdyhlwriigxulqj:5,7(6
logic devices incorporated www.logicdevices.com 143 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 1rplqdo2'7uhvlvwdqfh5 tt b120lvghilqhge\05>@dvvkrzqlq)ljxuh7kh5 tt b120whuplqdwlrqydoxhdssolhvwrwkhrxwsxwslqvsuhylrxvo\ phqwlrqhg''56'5$0l02'vvxssruwpxowlsoh5 tt b120ydoxhvedvhgrq5=4qzkhuhqfdqehrudqg5=4lv : ?5 tt b120whuplqd - wlrqlvdoorzhgdq\wlphdiwhuwkh6'5$0lvlqlwldol]hgfdoleu dwhgdqgqrwshuiruplqj5($'dffhvvhvruzkhqlwlvqrwlq6(/)5()5(6+prgh :5,7(dffhvvxvhv5 tt b120lgg\qdplf2'7 5 tt b:5 lvglvdeohg,i5 tt b120lvxvhggxulqj:5,7(vrqo\5=45=4dqg5=4duhdoo rzhg vhh 7deoh 2'7wlplqjvduhvxppdul]hglq7deohdvzhoodvolvwhglq7deoh ([dpsohvriqrplqdo2'7wlplqjduhvkrzqlqfrqmxqfwlrqzlwkwk hv\qfkurqrxvprghrirshudwlrqlqv6\qfkurqrxv2'70rghw t able 68: odt p arameter symbol description begins at defined to units 2'7uhjlvwhuhg+,*+ 2'7uhjlvwhuhg+,*+ 2'7uhjlvwhuhg+,*+ 2'7uhjlvwhuhg+,*+ 2'7uhjlvwhuhg+,*+ru:5,7( uhjlvwudwlrqzlwk2'7+,*+ :5,7(uhjlvwudwlrqzlwk2'7+,*+ &rpsohwlrqri2'7/rq &rpsohwlrqri2'7/rii odtl on odtl off t $213' t $2))3' 2'7+ 2'7+ t $21 t $2) 2'7v\qfkurqrxvwxuqrqghod\ 2'7v\qfkurqrxvwxuqriighod\ 2'7dv\qfkurqrxvrqghod\ 2'7dv\qfkurqrxvrqghod\ 2'7plqlpxp+,*+wlphdiwhu2'7dvvhuwlrq ru:5,7( %& 2'7plqlpxp+,*+wlphdiwhu:5,7( %/ 2'7wxuqrquhodwlyhwr2'7/rqfrpsohwlrq 2'7wxuqriiuhodwlyhwr2'7/riifrpsohwlrq r tt b21? t $21 r tt b21? t $2) r tt _on r tt _off 2'7uhjlvwhuhg/2: 2'7uhjlvwhuhg/2: r tt _on r tt _off &:/$/ &:/$/ 1-9 1-9 4 t &. 6 t &. 6hh7deoh 0.5 t &.? t &. t &. t &. ns ns t &. t &. ps t &. definition for all ddr3 bins dynamic odt ,qfhuwdlqdssolfdwlrqvwrixuwkhuhqkdqfhvljqdolqwhjulw\rqwkhgdwdexvlwlvghvludeohwkdwwkhwhuplqdwlrqvwuhqjwkehfkdqjhgzlwkrxwlvvxlqjdq056 frppdqghvvhqwldoo\fkdqjlqjwkh2'7whuplqdwlrquhvlvwdqfhrq wkhio\:lwkg\qdplf2'7 5 tt b:5 hqdeohgwkh6'5$0vzlwfkhviurpqrplqdo2'7 5 tt b120 wrg\qdplf2'7zkhqehjlqqlqjd:5,7(exuvwdqgvxevhtxhq wo\vzlwfkhvedfnwrqrplqdo2'7dwwkhfrpsohwlrqriwkh:5,7(exuvwvhtxhqfh 7klvuhtxluhphqwdqgwkhvxssruwlqj'<1$0,&2'7ihdwxuhriwkh ''56'5$0pdnhvlwihdvleohdqglvghvfulehglqixuwkhughwdloehorz dynamic odt f unctional d escription : 7khg\qdplf2'7prghlvhqdeohglihlwkhu05>@rup5>@lvvhwwrvw'\qdplf2'7lvqrwvxssruwhggxulqj'//glvdeohprghvr5 tt b:5pxvweh glvdeohg7khg\qdplf2'7ixqfwlrqlvghvfulehgdviroorzv x7zr5 tt ydoxhvduhdydlodeohy5 tt _nom and r tt b:5 x7khydoxhri5 tt b120lvsuhvhohfwhgyld05>@ x7khydoxhiru5 tt b:5lvsuhvhohfwhgyld05>@ x'xulqj6'5$0rshudwlrqvzlwkrxw5($'ru:5,7(frppdqgvwkhw huplqdwlrqlvfrqwuroohgdviroorzv x7huplqdwlrq212))wlplqjlvfrqwuroohgyldwkh2'7edoodqg/$7(1&,(62'7orqdqg2'7/rii x1rplqdowhuplqdwlrqvwuhqjwk5 tt _nom is used x:khqd:5,7(frppdqg :5:5$3:56:56:5$36:5$36 l vuhjlvwhuhgdqglig\qdplf2'7lvhqdeohgwkh2'7whu - plqdwlrqlvfrqwuroohgdviroorzv x$odwhqf\ri2'7/&1:diwhuwkh:5,7(frppdqgwhuplqdwlrqvwu hqjwk5 tt b120vzlwfkhvwr5 tt b:5 x$/dwhqf\ri2'7/&:1 iru%/il[hgru27) ru2'7/&:1 iru%&il[hgru27) diwhuwkh:5,7(frppdqgwhuplqdwlrq strength r tt b:5vzlwfkhvedfnwr5 tt _nom x212))whuplqdwlrqwlplqjlvfrqwuroohgyldwkh2'7edoodqgghwhuplqhge\2'7/rq2'7/rii2'7+dqg2'7+ x during the t $'&wudqvlwlrqzlqgrzwkhydoxhri5 tt lvxqghilqhg 2'7lvfrqvwudlqhggxulqj:5,7(vdqgzkhqg\qdplf2'7lvhqdeoh g vhh7deoh  nominal odt
logic devices incorporated www.logicdevices.com 144 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 69: dynamic odt s pecific p arameters symbol description begins at defined t o units :5,7(uhjlvwudwlrq :5,7(uhjlvwudwlrq :5,7(uhjlvwudwlrq odtl &1: odtl &1: odtl &:1 odtl &:1 t $'& &kdqjhiurp5 tt _nom to r tt b:5 &kdqjhiurp5 tt b:5wr5 tt b120 %& &kdqjhiurp5 tt b:5wr5 tt b120 %/ r tt fkdqjhvnhz r tt vzlwfkhgiurp5 tt _nom to r tt b:5 r tt vzlwfkhgiurp5 tt b:5wr5 tt _nom r tt vzlwfkhgiurp5 tt b:5wr5 tt _nom r tt wudqvfrpsohwh :/ 4 t &.2'7/2)) 6 t &.2'7/2)) 0.5 t &.? t &. t &. t &. t &. t &. definition for all ddr3 bins t able 70: mode registers for rtt_nom m9 m6 m2 rtt_nom (rzq) rtt_nom(ohms) rtt_nom mode restriction 0 0 0 0 1 1 1 1 2ii 5=4 5=4 5=4 5=4 5=4 reserved reserved n/a 6(/)5()5(6+ 6(/)5()5(6+:5,7( n/a n/a 0 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 2ii 60 120 40 20 30 reserved reserved mr1(rtt_nom) t able 71: mode registers for r tt _wr m10 m2 r tt _nom (rzq) r tt _nom(ohms) 0 0 1 1 n/a n/a n/a n/a 5=4 5=4 reserved n/a n/a n/a n/a 0 1 0 1 n/a n/a n/a n/a 60 120 reserved n/a n/a n/a n/a mr1(r tt _nom) dynamic odt off: write does not affect r tt _nom t able 72: timing diagrams for dynamic odt figure title figure 101 figure 102 figure 103 figure 104 figure 105 '\qdplf2'72'7dvvhuwhgehiruhdqgdiwhuwkh:5,7(%& '\qdplf2'7:lwkrxw:5,7(frppdqg '\qdplf2'72'7slqdvvhuwhgwrjhwkhuzlwk:5,7(frppdqgiru&.f\fohv%/ '\qdplf2'72'7slqdvvhuwhgzlwk:5,7(frppdqgiru&.f\fohv%& '\qdplf2'72'7slqdvvhuwhgzlwk:5,7(frppdqgiru&.f\fohv%&
logic devices incorporated www.logicdevices.com 145 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 101 - d ynamic odt: odt a sserted b efore and a fter the write, bc4 notes: 1. via mrs or otf. al = 0, cwl = 5. r tt _ nom and r tt _ wr are enabled. 2. odth4 applies to first registering odt high and then to the registration of the write command. in this example, odth4 is satisfied if odt goes low at t8 (four clocks after the write command). t0 t1 t2 t3 t4 t5 t 6t7t8t9 odtl on odtl cw n 4 odtl cn w wl odtl off t10 t11 t12 t13 t14 t15 t17 t16 ck ck # command add ress r tt odt dq dqs, dqs# vali d wrs4 pon pon pon pon pon nop nop don t care transitioning r tt _ wr r tt _ nom r tt _ nom di n + 3 di n + 2 di n + 1 di n nop nop nop nop nop nop nop nop nop nop odth4 odth4 t aon (min) t adc (min) t adc (min) t aof (min) t aon (max) t adc (max) t adc (max) t aof (max) f igure 102 - d ynamic odt: w ithout write c ommand notes: 1. al = 0, cwl = 5. r tt _ nom is enabled and r tt _ wr is either enabled or disabled. 2. odth4 is defined from odt registered high to odt registered low; in this example, odth4 is satisfied. odt registered low at t5 is also legal. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 odtl off t10 t11 ck ck# r tt don t care transitionin g command vali d vali d vali d vali d vali d vali d vali d vali d vali d vali d vali d vali d add ress dqs, dqs# dq odth4 odtl on t aon (max) t aon (min) t aof (min) t aof (max) odt r tt _ nom
logic devices incorporated www.logicdevices.com 146 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 103 - d ynamic odt: odt p in a sserted t ogether with write c ommand for 6 c lock c ycles , bl8 notes: 1. via mrs or otf; al = 0, cwl = 5. if r tt _ nom can be either enabled or disabled, odt can be high. r tt _ wr is enabled. 2. in this example, odth8 = 6 is satisfied exactly. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 odtl cw n 8 odtl on odtl cn w wl t aof (max) t10 t11 ck ck# add ress r tt odt dq dqs, dqs# di b + 3 di b + 2 di b + 1 di b di b+ 7 di b + 6 di b + 5 di b + 4 vali d don t care transitioning command wrs8 nop nop nop nop nop nop nop nop nop nop nop r tt _ wr odth8 odtl off t adc (max) t aon (min) t aof (min) f igure 104 - d ynamic odt: odt p in a sserted with write c ommand for 6 c lock c ycles , bc4 notes: 1. via mrs or otf. al = 0, cwl = 5. r tt _ nom and r tt _ wr are enabled. 2. odth4 is defined from odt registered high to odt registered low, so in this example, odth4 is satisfied. odt registered low at t5 is also legal. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 odtl on odtl cn w wl t10 t11 ck ck# odtl cw n 4 dqs, dqs# address vali d don t care transitioning odtl off command wrs4 nop nop nop nop nop nop nop nop dq di n+ 3 di n + 2 di n + 1 di n t adc (min) t aof (min) t aof (max) t adc (max) t adc (max) t aon (min) odth4 odt r tt r tt _ wr r tt _ nom nop nop nop
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 105 - d ynamic odt: odt p in a sserted with write c ommand for 4 c lock c ycles , bc4 notes: 1. via mrs or otf. al = 0, cwl = 5. r tt _ nom can be either enabled or disabled. if disabled, odt can remain high. r tt _ wr is enabled. 2. in this example odth4 = 4 is satisfied exactly. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 odtl on odtl cn w wl t10 t11 ck ck# odtl cw n 4 dqs, dqs# add ress valid r tt _ wr command wrs4 nop nop nop nop nop nop nop nop nop don t care transitioning dq di n di n + 3 di n + 2 di n + 1 odth4 t adc (max) t aon (min) t aof (min) t aof (max) odtl off r tt r tt _ wr odt nop nop synchronous odt mode 6\qfkurqrxv2'7lvvhohfwhgzkhqhyhuwkh'//lvwxuqhgrqdqgorfnhg zkloh 5 tt _nom or r tt b:5 lv hqdeohg  %dvhg rq wkh  32:(5'2:1 ghilqlwlrqwkhvhprghvduh x$q\edqn$&7,9(zlwk&.(+,*+ x5()5(6+prghzlwk&.(+,*+ x'/(prghzlwk&.(+,*+ x$&7,9(32:(5'2:1prgh uhjdugohvvri 05>@ x35(&+$5*(32:(5'2:1prghli'//lv hqdeohggxulqj35(&+$5*(32:(5'2:1e\ mr0[12] odt latency and posted odt ,qv\qfkurqrxv2'7prgh5 tt wxuqvrq2'7/rqforfnf\fohvdiwhu2'7 lvvdpsohg+,*+e\dulvlqjforfnhgjhdqgwxuqvrii2'7/riiforfnf\fohv diwhu2'7lvuhjlvwhuhg/2:e\dulvlqjforfnhgjh7khdfwxdo rqriiwlphv ydulhve\ t $21dqg t $2)durxqghdfkforfnhgjh vhh7deoh 7kh2'7 /$7(1&<lvwlhgwrwkh:5,7(/$7(1&< :/ e\2'7/rq :/dqg 2'7/rii :/ 6lqfh:5,7(/$7(1&<lvpdghxsri&$6:5,7(/$7(1&< &:/ dqg $'',7,9(/$7(1&< $/ wkh$/ydoxhsurjudpphglqwrwkhprghuh jlv- whu05>@dovrdssolhvwrwkh2'7vljqdo7kh6'5$0uvlqwhuqdo2'7 vljqdolvghod\hgdqxpehuriforfnf\fohvghilqhge\wkh$/uhodwlyhwrwkh h[whuqdo2'7vljqdo7kxv2'7/rq &:/$/ydqg2'7/rii  &:/ $/y
logic devices incorporated www.logicdevices.com 148 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product synchronous odt t iming p arameters 6\qfkurqrxv2'7prghxvhvwkhiroorzlqjwlplqjsdudphwhuv2'7/ rq2'7/rii2'7+2'7+ t $21dqg t $2) vhh7deohdqg)ljxuh 7kh plqlpxp5 tt wxuqrqwlph t $21>0,1@ lvwkhsrlqwdwzklfkwkhghylfhohdyhv+,*+$dqg2'7uhvlvwdqfhehjlqvwrwxuqrq0d[lpxp5 tt wxuqrqwlph t $21>0$;@ lvwkhsrlqwdwzklfk2'7uhvlvwdqfhlvixoo\rq%rwkduhphdvxuhguhodwlyhwr2'7/rq7khplqlpxp5 tt wxuqriiwlph t $2)>plq@ lvwkh srlqwdwzklfkwkhghylfhvwduwvwrwxuqrii2'7uhvlvwdqfh0 d[lpxp5 tt wxuqriiwlph t $2)>0$;@ lvwkhsrlqwdwzklfk2'7kdvuhdfkhg+,*+=%rwk duh phdvxuhgiurp2'7/rii :khq2'7lvdvvhuwhglwpxvwuhpdlq+,*+xqwlo2'7+lvvdwlvi lhg,id:5,7(frppdqglvuhjlvwhuhge\wkh6'5$0zlwk2'7+, *+wkhq2'7pxvw uhpdlq+,*+xqwlo2'7+ %& ru2'7+ %/ diwhuwkh:5,7(fr ppdqg vhh)ljxuh 2'7+dqg2'7+duhphdvxuhgiurp2'7uhjlvwhuhg+,*+ wr2'7uhjlvwhuhg/2:ruiurpwkhuhjlvwudwlrqrid:5,7(frppdqgxqwlo2'7lvuhjlvwhuhg/2: t able 73: synchronous odt p arameters symbol description begins at defined to units 2'7uhjlvwhuhg+,*+ 2'7uhjlvwhuhg+,*+ 2'7uhjlvwhuhg+,*+ru:5,7( uhjlvwudwlrqzlwk2'7+,*+ :5,7(uhjlvwudwlrqzlwk2'7+,*+ &rpsohwlrqri2'7/rq &rpsohwlrqri2'7/rii odtl on odtl off 2'7+ 2'7+ t $21 t $2) 2'7v\qfkurqrxv785121ghod\ 2'7v\qfkurqrxv78512))ghod\ 2'70lqlpxp+,*+wlphdiwhu2'7 dvvhuwlrqru:5,7( %& 2'70lqlpxp+,*+wlphdiwhu :5,7( %/ 2'7785121uhodwlyhwr2'7/rq frpsohwlrq 2'778512))uhodwlyhwr2'7/rii frpsohwlrq r tt b21? t $21 r tt b2))? t $2) 2'7uhjlvwhuhg/2: 2'7uhjlvwhuhg/2: r tt _on r tt _off &:/$/ &:/$/ 4 t f. 6 t f. 6hh7deoh 0.5 t f.? t f. t &. t &. t &. t &. ps t &. definition for all ddr3 bins f igure 106 - s ynchronous odt notes: 1. al = 3; cwl = 5; odtl on = wl = 6.0; odtl off = wl - 2 = 6. r tt _ nom is enabled. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 cw l - al = 3 al = 3 t aon (max) t10 t11 t12 ck ck # r tt odt r tt _ nom ck e odtl off = cwl + al - 2 odtl on = cwl + al - 2 odth4 (min) t aon (min)
logic devices incorporated www.logicdevices.com 149 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 107 - s ynchronous odt (bc4) notes: 1. wl = 7. r tt _ nom is enabled. r tt _ wr is disabled. 2. odt must be held high for at least odth4 after assertion (t1). 3. odt must be kept high odth4 (bc4) or odth8 (bl8) after the write command (t7). 4. odth is measured from odt first registered high to odt first registered low or from the registration of the write command with odt high to odt registered low. 5. although odth4 is satisfied from odt registered high at t6, odt must not go low before t11 as odth4 must also be satisfied from the registration of the write command at t7. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t aof (max) t aof (min) t aon (max) t aof (max) t10 t11 t12 t13 t14 t15 t17 t16 ck ck# r tt ck e nop wrs4 nop nop nop nop nop nop command don t care transitioning t aon (min) r tt _ nom odtloff = wl - 2 odth4 (min) odth4 odtl off = wl - 2 odtl on = wl - 2 t aon (min) t aon (max) odth4 odtl on = wl - 2 t aof (min) odt r tt _ nom nop nop nop nop nop nop nop nop nop nop odt off d uring reads $vwkh''56'5$0fdqqrwwhuplqdwhdqggulyhdwwkhvdphwlph 5 tt pxvwehglvdeohgdwohdvwrqhkdoiforfnf\fohehiruhwkh5($'suhdpeohe\gulylqj wkh2'7edoo/2:5 tt pd\qrwehhqdeohgxqwlowkhhqgriwkhsrvwdpeohdvvkrzqlq)ljxuh f igure 108 - odt d uring read s notes: 1. odt must be disabled externally during reads by driving odt low. for example, cl = 6; al = cl - 1 = 5; rl = al + cl = 11; cwl = 5; odtl on = cwl + al - 2 = 8; odtl off = cwl + al - 2 = 8. r tt _ nom is enabled. r tt _ wr is a dont care. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t10 t11 t12 t13 t14 t15 t17 t16 ck ck# vali d add ress di b + 3 di b + 2 di b + 1 di b di b + 7 di b + 6 di b+ 5 di b+ 4 dq dqs, dqs# don t care transitioning command nop nop nop nop nop nop nop nop nop nop nop nop nop nop nop nop nop read odtl on = cwl + al - 2 odt t aon (max) rl = al + cl odtl off = cwl + al - 2 t aof (min) r tt r tt _ nom r tt _ nom t aof (max)
logic devices incorporated www.logicdevices.com 150 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product asynchronous odt mode $v\qfkurqrxv2'7prghlvdydlodeohzkhqwkh6'5$0uxqvlq'//21prghdqgzkhqhlwkhu5 tt _nom or r tt b:5lvhqdeohgkrzhyhuwkh'//lvwhp - srudulo\wxuqhgriilq35(&+$5*('32:(5'2:1vwdqge\yld05>@$gglwlrqdoo\2'7rshudwhvdv\qfkurqrxvo\zkhqwkh'//lvv\qfkurql]lqjdiwhu ehlqj5(6(76hhv32:(5'2:102'(wirughilqlwlrqdqgjxlgdqfhryhu32:(5'2:1ghwdlov ,qdv\qfkurqrxv2'7wlplqjprghwkhlqwhuqdo2'7frppdqglvqrwghod\hge\$/uhodwlyhwrwkhh[whuqdo2'7frppdqg,qdv\qfkurqrxv2'7prgh2'7 frqwurov5 tt e\dqdorjwlph7khwlplqjsdudphwhuv t $213'dqg t $2)3' vhh7deoh uhsodfh2'7/rq t $21dqg2'7/rii t $2)uhvshfwlyho\zkhq2'7 rshudwhvdv\qfkurqrxvo\ vhh)ljxuh  7khplqlpxp5 tt wxuqrqwlph t $213'>0,1@ lvwkhsrlqwdwzklfkwkhghylfhwhuplqdwlrqflufxlwohdyhv+,*+=dqg2'7uhvlvwdqfhehjlqvwrwxuqrq0d[l - pxp5 tt wxuqrqwlph t $213'>0$;@ lvwkhsrlqwdwzklfk2'7uhvlvwdqfhlvixoo\rq t $213' 0,1 dqg t $213' 0$; duhphdvxuhgiurp2'7ehlqj vdpsohg+,*+ 7khplqlpxp5 tt wxuqriiwlph t $2)3'>0,1@ lvwkhsrlqwdwzklfkwkhghylfhwhuplqdwlrqflufxlwvwduwvwrwxuqrii2'7uhvlvwdqfh0d[lpxp5 tt wxuqriiwlph t $2)3'>0$;@ lvwkhsrlqwdwzklfk2'7kdvuhdfkhg+,*+= t $2)3' 0,1 dqg t $2)3' 0$; duhphdvxuhgiurp2'7ehlqjvdpsohg/2: t able 74: asynchronous odt t iming p arameters for a ll s peed b ins symbol description min max units t $21 pd t $2) pd $v\qfkurqrxv5 tt 785121ghod\ 32:(5'2:1zlwk'//rii $v\qfkurqrxv5 tt 78512))ghod\ 32:(5'2:1zlwk'//rii 2 2 8.5 8.5 ns ns f igure 109 - a synchronous odt t iming with f ast odt t ransition notes: 1. al is ignored. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t aonpd (max) t aofpd (max) t10 t11 t12 t13 t14 t15 t17 t16 ck ck # r tt odt r tt _ nom don t care transitioning ck e t ih t is t ih t is t aofpd (min) t aonpd (min)
logic devices incorporated www.logicdevices.com 151 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product t able 75: odt p arameters for power-down (dll off) e ntry and e xit t ransition p eriod description min max 32:(5'2:1hqwu\wudqvlwlrqshulrg 32:(5'2:1hqwu\ 32:(5'2:1hqwu\wudqvlwlrq 32:(5'2:1h[lw odt to r tt 785121ghod\ 2'7/rq :/ odt to r tt 78512))ghod\ 2'7/rii :/ t $1 pd *uhdwhuri t $1 pd or t 5)&5()5(6+wr&.(/2: t $1 3' t ;3'// :/ *uhdwhuri2'7/riiru2'7/rq /hvvhuri t $1 pd 0,1 >qv@ru odl on x t &. t $21 0,1 /hvvhuri t $2) pd 0,1 >qv@ru 2'/rii[ t &. t $2) 0,1 /hvvhuri t $1 pd 0,1 >qv@ru odl on x t &. t $21 0,1 /hvvhuri t $2) pd 0,1 >qv@ru 2'/rii[ t &. t $2) 0,1 synchronous to asynchronous odt mode transition (power-down entry) 7khuhlvdwudqvlwlrqshulrgdurxqg32:(5'2:1(175< 3'( zkhuhwkh6'5$0uv2'7pd\h[klelwhlw khuv\qfkurqrxvrudv\qfkurqrx vehkdylru7klv wudqvlwlrqshulrgrffxuvliwkh'//lvvhohfwhgwrehriizkhq lq35(&+$5*(32:(5'2:1prghe\wkhvhwwlqjri05>@ 32:(5'2:1hqwu\ ehjlqv t $13'sulruwr&.(iluvwehlqjuhjlvwhuhg/2:dqglwhqgvzkhq& /(lviluvwuhjlvwhuhg/2: t $13'lvhtxdowrwkhjuhdwhuri2'7/rii t &.ru2'7/ rq t &.,id5()5(6+frppdqgkdvehhqlvvxhgdqglwlvlqsurjuhvvzkhq&.(jrhv/2:32:(5'2:1hqwu\zloohqg t 5)&diwhuwkh5()5(6+ frppdqgudwkhuwkdqzkhq&.(lviluvwuhjlvwhuhg/2:32:(5'2:1(175<zloowkhqehfrphwkhjuhdwhuri t $13'dqg t 5)&y5()5(6+frppdqg wr&.(uhjlvwhuhg/2: 2'7dvvhuwlrqgxulqj32:(5'2:1(175<uhvxowvlqdq5 tt fkdqjhdvhduo\dvwkhohvvhuri t $213' 0,1 dqg2'7/rq[ t &. t $21 0,1 rudvodwh dvwkhjuhdwhuri t $213' 0$; dqg2'7/rq[ t &. t $21 0$; 2'7ghdvvhuwlrqgxulqj32:(5'2:1(175<pd\uhvxow lqdq5 tt fkdqjhdvhduo\ dvwkhohvvhuri t $2)3' 0,1 dqg2'7/rii[ t &. t $2) 0,1 rudvodwhdvwkhjuhdwhuri t $2)3' 0$; dqg2'7/rii[ t &. t $2) 0$; 7deoh vxppdul]hvwkhvhsdudphwhuv ,iwkh$/kdvdodujhydoxhwkh xqfhuwdlqw\riwkhvwdwhri5 tt ehfrphvtxlwhodujh7klvlvehfdxvh2'7/rqdqg2'7/riiduh ghulyhgiurpwkh:/dqg:/ lvhtxdowr&:/$/)ljxuhvkrzvwkuhhgliihuhqwfdvhv x2'7b$6\qfkurqrxvehkdylruehiruh t $13' x2'7b%2'7vwdwhfkdqjhvgxulqjwkhwudqvlwlrqshulrgzlwk t $213' 0,1 ohvvwkdq2'7/rq[ t &. t $21 0,1 dqg t $213' 0$;  greater than odtl on x t &. t $21 0$; x2'7b&2'7vwdwhfkdqjhvdiwhuwkhwudqvlwlrqshulrgzlwkdv\ qfkurqrxvehkdylru
logic devices incorporated www.logicdevices.com 152 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product asynchronous to synchronous odt mode transition (power-down exit) 7kh6'5$0uv2'7pd\h[klelwhlwkhudv\qfkurqrxvruv\qfkurqrxvehkdylrugxulqj32:(5'2:1(;,7 3'; 7klvwudqvlwlrqshulrg rffxuvliwkh'//lv vhohfwhgwrehriizkhqlq35(&+$5*(32:(5'2:1prghe\vhwwlqj 05>@wrvw32:(5'2:1h[lwehjlqv t $13'sulruwr&.(iluvwehlqjuhjlv - whuhg+,*+dqglwhqgv t ;3'//diwhu&.(lviluvwuhjlvwhuhg+,*+ t $13'lvhtxdowrwkhjuhdwhuri2'7/rii t &.ru2'7/rq t &.7khwudqvlwlrqshulrg is t $13'soxv t ;3'// 2'7dvvhuwlrqgxulqj32:(5'2:1h[lwuhvxowvlqdq5 tt fkdqjhdvhduo\dvwkhohvvhuri t $213' 0,1 dqg2'7/rq[ t &. t $21 0,1 rudvodwhdv wkhjuhdwhuri t $213' 0$; dqg2'7/rq[ t &. t $21 0$; 2'7ghdvvhuwlrqgxulqj32:(5'2:1(;,7pd\uhvxow lqdq5 tt fkdqjhdvhduo\dvwkh ohvvhuri t $2)3' 0,1 dqg2)7/rii[ t &. t $2) 0,1 rudvodwhdvwkhjuhdwhuri t $2)3' 0$; dqg2'7/rii[ t &. t $2) 0$; 7deohvxppdul]hv wkhvhsdudphwhuv ,iwkh$/kdvdodujhydoxhwkhxqfhuwdlqw\riwkh5 tt vwdwhehfrphvtxlwhodujh7klvlvehfdxvh2'7/rqdqg2'7/r iiduhghulyhgiurpwkh:/dqgwkh:/ lvhtxdowr&:/$/)ljxuhvkrzvwkuhhgliihuhqwfdvhv x2'7&$v\qfkurqrxvehkdylruehiruh t $13' x2'7%2'7vwdwhfkdqjhvgxulqjwkhwudqvlwlrqshulrgzlwk t $2)3' 0,1 ohvvwkdq2'7/rii[ t &. t $2) 0,1 dqg2'7/rii[ t &. t $2) 0$; juhdwhuwkdq t $2)3' 0$; x2'7$2'7vwdwhfkdqjhvdiwhuwkhwudqvlwlrqshulrgzlwkv\q fkurqrxvuhvsrqvh f igure 110 - s ynchronous to a synchronous t ransition d uring p recharge p ower -d own (dll o ff ) e ntry notes: 1. al = 0; cwl = 5; odtl off = wl - 2 = 3. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 t aofpd (max) odtl off t10 t11 t12 t13 ta0 ta1 ta3 ta2 ck ck# dram r tt b asynchronous or synchronous r tt _ nom dram r tt c asynchronous r tt _ nom don t care transitioning ck e nop nop nop nop nop command nop ref nop nop nop nop nop nop nop nop nop nop nop pde transition perio d indicates a break in time scale odtl off + t aofpd (min) t aofpd (max) t aofpd (min) odtl off + t aofpd (max) t aofpd (min) t anpd t aof (min) t aof (max) dram r tt a synchronous r tt _ nom odt a synchronous odt c asynchronous odt b asynchronous or synchronous t rfc (min)
logic devices incorporated www.logicdevices.com 153 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product f igure 111 - a synchronous to s ynchronous t ransition d uring p recharge p ower -d own (dll o ff ) e xit notes: 1. cl = 6; al = cl - 1; cwl = 5; odtl off = wl - 2 = 8. t0 t1 t2 ta0 ta1 ta2 ta3 ta4 ta5 ta 6 t b0 tb1 tb2 tc0 tc1 td 0 td 1 tc2 ck ck# don t care transitioning odt c synchronous pon pon nop command nop nop nop nop r tt b asynchronous or synchronous dram r tt a asynchronous dram r tt c synchronous r tt _ nom nop nop odt b asynchronous or synchronous ck e t aof (min) r tt _ nom indicates a break in time scale odtl off + t aof (min) t aofpd (max) odtl off + t aof (max) t xpdll t aof (max) odtl off odt a asynchronous pdx transition period t aofpd (min) t aofpd (max) t anpd t aofpd (min) r tt _ nom nop nop nop nop nop
logic devices incorporated www.logicdevices.com 154 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product asynchronous to synchronous odt mode transition (short cke pulse) ,iwkhwlphlqwkh35(&+$5*(32:(5'2:1ru,'/(vwdwhvlvyhu\vkruw vkruw&.(/2:sxohv wkh32:(5'2:1(175<dqg32:(5'2:1(;,7 wudqvlwlrqshulrgvzlooryhuods:khqryhuodsrffxuvwkhuhvs rqvhriwkh6'5$0uv5 tt wrdfkdqjhlqwkh2'7vwdwhpd\ehv\qfkurqrxvrudv\qfkurqrx v iurpwkhvwduwriwkh32:(5'2:1(175<wudqvlwlrqshulrgwrwkh hqgriwkh32:(5'2:1(;,7wudqvlwlrqshulrghyhqliwkh(175< shulrghqgvodwhu wkdqwkh(;,7shulrg vhh)ljxuh  ,iwkhwlphlqwkhlgohvwdwhlvyhu\vkruw vkruw&.(+,*+sxo vh wkh32:(5'2:1(;,7dqg32:(5'2:1(175<wudqvlwlrqshulrg vryhuods:khqwklv ryhuodsrffxuvwkhuhvsrqvhriwkh6'5$0uv5 tt wrdfkdqjhlqwkh2'7vwdwhpd\ehv\qfkurqrxvrudv\qfkurqr xviurpwkhvwduwriwkh32:(5'2:1 (;,7wudqvlwlrqshulrgwrwkhhqgriwkh32:(5'2:1(175<wudqvlwlrqshulrg vhh)ljxuh  f igure 112 - t ransition p eriod for s hort cke low c ycles with e ntry and e xit p eriod o verlapping notes: 1. al = 0, wl = 5, t anpd = 4. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 ta0 ta1 ta2 ta3 ta4 ck ck# ck e command don t care transitionin g t xpdll t rfc (min) nop nop nop nop nop nop nop nop nop nop ref pon pon nop nop pde transition period pdx transition perio d indicates a break in time scale t anpd short cke low transition period (r tt chan ge asynchronous or syn chronous) t anpd f igure 113 - t ransition p eriod for s hort cke high c ycles with e ntry and e xit p eriod o verlapping notes: 1. al = 0, wl = 5, t anpd = 4. t0 t1 t2 t3 t4 t5 t6 t7 t8 t9 ck ck# c ommand don t care transitionin g nop nop nop nop nop nop nop nop nop nop nop pon pon nop nop nop t anpd t xpdll indicates a break in time scale t a 0 t a 1 t a 2 t a 3 t a 4 cke short cke high transition period (r tt chan ge asynchronous or synchonous) t anpd
logic devices incorporated www.logicdevices.com 155 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product list of figures )ljxuh''53duw1xpehuv  )ljxuh6lpsolilhg6wdwh'ldjudp  )ljxuh)xqfwlrqdo%orfn'ldjudp  )ljxuh6'5$0''53lqrxw7rs9lhz  )ljxuh0hfkdqlfdo'udzlqj  )ljxuh,qsxw6ljqdo  )ljxuh2yhuvkrrw6shflilfdwlrqv  )ljxuh8qghuvkrrw6shflilfdwlrqv  )ljxuh9 ,; iru'liihuhqwldo6ljqdov  )ljxuh6lqjoh(qghg5htxluhphqwviru'liihuhqwldo6ljqdov  )ljxuh'hilqlwlrqri'liihuhqwldo$&6zlqjdqg t '9$& )ljxuh1rplqdo6ohz5dwh'hilqlwlrqiru6lqjoh(qghg,qsxw6ljqdov  )ljxuh1rplqdo'liihuhqwldo,qsxw6ohz5dwh'hilqlwlrqiru '46'46dqg&.&.  )ljxuh2'7/hyhovdqg,9&kdudfwhulvwlfv  )ljxuh2'77lplqj5hihuhqfh/rdg  figure 16: t $21dqg t $2)'hilqlwlrqv  )ljxuh t $213'dqg t $2)3''hilqlwlrq  figure 18: t $'&'hilqlwlrq  figure 19: output driver 40 figure 20: dq output signal 45 )ljxuh'liihuhqwldo2xwsxw6ljqdo  )ljxuh5hihuhqfh2xwsxw/rdgiru$&7lplqjdqg2xwsxw6ohz 5dwh )ljxuh1rplqdo6ohz5dwh'hilqlwlrqiru6lqjoh(qghg2xwsxw6ljqdov  )ljxuh1rplqdo'liihuhqwldo2xwsxw6ohz5dwh'hilqlwlrqir u'46'46 )ljxuh1rplqdo6ohz5dwhdqg t 9$&iru t ,6 &rppdqgdqg$gguhvv&orfn   )ljxuh1rplqdo6ohz5dwhiru t ,+ &rppdqgdqg$gguhvv&orfn   )ljxuh7dqjhqw/lqhiru t ,6 &rppdqgdqg$gguhvv&orfn   )ljxuh7dqjhqw/lqhiru t ,+ &rppdqgdqg$gguhvv&orfn   )ljxuh1rplqdo6ohz5dwhdqg t 9$&iru t '6 '46wureh   )ljxuh1rplqdo6ohz5dwhiru t '+ '46wureh   )ljxuh1rplqdo6ohz5dwhdqg t 9$&iru t '6 '46wureh   )ljxuh1rplqdo6ohz5dwhiru t '+ '46wureh   )ljxuh5hiuhvk0rgh  )ljxuh'//(qdeoh0rghwr'//'lvdeoh0rgh  )ljxuh'//'lvdeoh0rghwr'//(qdeoh0rgh  )ljxuh'//'lvdeoh t '46&.7lplqj  )ljxuh&kdqjh)uhtxhqf\'xulqj3uhfkdujh3rzhu'rzq  )ljxuh:ulwh/hyholqj&rqfhsw  )ljxuh:ulwh/hyholqj6htxhqfh  )ljxuh([lw:ulwh/hyholqj  )ljxuh,qlwldol]dwlrq6htxhqfh  )ljxuh056wr056&rppdqg7lplqj t 05'  )ljxuh056wrqrq056&rppdqg7lplqj t 02'  )ljxuh0rgh5hjlvwhu 05 'hilqlwlrqv  )ljxuh5($'/dwhqf\  )ljxuh0rgh5hjlvwhu 05 'hilqlwlrq  )ljxuh5($'/dwhqf\ $/ &/    )ljxuh0rgh5hjlvwhu 05 'hilqlwlrq 
logic devices incorporated www.logicdevices.com 156 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product )ljxuh&$6:ulwh/dwhqf\  )ljxuh0rgh5hjlvwhu 05 'hilqlwlrq  )ljxuh0xowlsxusrvh5hjlvwhu 035 %orfn'ldjudp  )ljxuh0356\vwhp5hdg&doleudwlrqzlwk%/)l[hg%xuvw2ughu6lqjoh5hdgrxw  )ljxuh0356\vwhp5hdg&doleudwlrqzlwk%/)l[hg%xuvw 2ughu%dfnwr%dfn5hdgrxw    )ljxuh0356\vwhp5hdg&doleudwlrqzlwk%&/rzhu1leeohwkhq8sshu1leeoh  )ljxuh0356\vwhp5hdg&doleudwlrqzlwk%&8sshu1leeohwkhq/rzhu1leeoh  )ljxuh=4&doleudwlrq7lplqj =4&/dqg=4&6   )ljxuh([dpsoh0hhwlqj t 55' 0,1 dqg t 5&' 0,1   )ljxuh([dpsoh t )$: )ljxuh5($'/dwhqf\  )ljxuh&rqvhfxwlyh5($'%xuvwv %/   )ljxuh&rqvhfxwlyh5($'%xuvwv %&   )ljxuh1rqfrqvhfxwlyh5($'%xuvwv  )ljxuh5($' %/ wr:5,7( %/   )ljxuh5($' %& wr:5,7( %& 27)  )ljxuh5($'wr35(&+$5*( %/   )ljxuh5($'wr35(&+$5*( %&   )ljxuh5($'wr35(&+$5*( $/ &/    )ljxuh5($'zlwk$xwr3uhfkdujh $/ &/    )ljxuh'dwd2xwsxw7lplqj t '464dqg'dwd9dolg:lqgrz  )ljxuh'dwd6wureh7lplqj5($'v  )ljxuh0hwkrgiru&dofxodwlqj t /=dqg t += )ljxuh t 535(7lplqj  )ljxuh t 53677lplqj  )ljxuh t :35(7lplqj  )ljxuh t :3677lplqj  )ljxuh:ulwh%xuvw  )ljxuh&rqvhfxwlyh:5,7( %/ wr:5,7( %/   )ljxuh&rqvhfxwlyh:5,7( %& yld056ru27)  )ljxuh1rqfrqvhfxwlyh:5,7(wr:5,7(  )ljxuh:5,7( %/ wr5($' %/   )ljxuh:5,7(wr5($' %&0rgh5hjlvwhu6hwwlqj   )ljxuh:5,7( %&27) wr5($' %&27)   )ljxuh:5,7( %/ wr35(&+$5*(  )ljxuh:5,7( %&0rgh5hjlvwhu6hwwlqj wr35(&+$5*(  )ljxuh:5,7( %&27) wr35(&+$5*(  )ljxuh'dwd,qsxw7lplqj  )ljxuh6hoi5hiuhvk(qwu\([lw7lplqj  )ljxuh$fwlyh3rzhu'rzq(qwu\dqg([lw  )ljxuh3uhfkdujh3rzhu'rzq )dvw([lw0rgh (qwu\dqg([l w )ljxuh3uhfkdujh3rzhu'rzq 6orz([lw0rgh (qwu\dqg([l w )ljxuh3rzhu'rzq(qwu\$iwhu5($'ru5($'zlwk$xwr3uhfkdujh 5'$3   )ljxuh3rzhu'rzq(qwu\$iwhu:5,7(  )ljxuh3rzhu'rzq(qwu\$iwhu:5,7(zlwk$xwr3uhfkdujh :5$3   )ljxuh5()5(6+wr3rzhu'rzq(qwu\  )ljxuh$&7,9$7(wr3rzhu'rzq(qwu\  )ljxuh35(&+$5*(wr3rzhu'rzq(qwu\  )ljxuh056&rppdqgwr3rzhu'rzq(qwu\  )ljxuh3rzhu'rzq([lwwr5hiuhvkwr3rzhu'rzq(qwu\ 
logic devices incorporated www.logicdevices.com  18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product )ljxuh5(6(76htxhqfh  )ljxuh2q'lh7huplqdwlrq  )ljxuh'\qdplf2'72'7$vvhuwhg%hiruhdqg$iwhuwkh:5 ,7(%& )ljxuh'\qdplf2'7:lwkrxw:5,7(&rppdqg  )ljxuh'\qdplf2'72'73lq$vvhuwhg7rjhwkhuzlwk:5,7( &rppdqgiru&orfn&\fohv%/   )ljxuh'\qdplf2'72'73lq$vvhuwhgzlwk:5,7(&rppdqg iru&orfn&\fohv%&    )ljxuh'\qdplf2'72'73lq$vvhuwhgzlwk:5,7(&rppdqg iru&orfnf\fohv%&    )ljxuh6\qfkurqrxv2'7  )ljxuh6\qfkurqrxv2'7 %&   )ljxuh2'7'xulqj5($'v  )ljxuh$v\qfkurqrxv2'7wlplqjzlwk)dvw2'77udqvlwlrq  )ljxuh6\qfkurqrxvwr$v\qfkurqrxv7udqvlwlrq'xulqj3uhf kdujh3rzhu'rzq '//2ii (qwu\   )ljxuh$v\qfkurqrxvwr6\qfkurqrxv7udqvlwlrq'xulqj3uhf kdujh3rzhu'rzq '//2ii ([lw   )ljxuh7udqvlwlrq3hulrgiru6kruw&.(/2:&\fohvzlwk(q wu\dqg([lw3hulrg2yhuodsslqj   )ljxuh7udqvlwlrq3hulrgiru6kruw&.(+,*+&\fohvzlwk( qwu\dqg([lw3hulrg2yhuodsslqj  
logic devices incorporated www.logicdevices.com 158 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product list of tables 7deoh$gguhvvlqj  7deoh%doo6ljqdo/rfdwlrqdqg'hvfulswlrq  7deoh$evroxwh0d[lpxp5dwlqjv  7deoh,qsxw2xwsxw&dsdflwdqfh  7deoh7lplqj3dudphwhuviru,''0hdvxuhphqwv&orfn8qlwv  7deoh, dd0 0hdvxuhphqw/rrs  7deoh, dd1 0hdvxuhphqw/rrs  7deoh, dd 0hdvxuhphqw&rqglwlrqviru3rzhu'rzq&xuuhqwv  7deoh, dd2n /i dd3n 0hdvxuhphqw/rrs  7deoh, dd2nt 0hdvxuhphqw/rrs  7deoh, dd4r 0hdvxuhphqw/rrs  7deoh, '': 0hdvxuhphqw/rrs  7deoh, dd5b 0hdvxuhphqw/rrs  7deoh, dd 0hdvxuhphqw/rrs  7deoh, '' 0hdvxuhphqw/rrs  7deoh, dd 0d[lpxp/lplwv 7deoh'&(ohfwulfdo&kdudfwhulvwlfvdqg2shudwlqj&rqglwlr qv 7deoh'&(ohfwulfdo&kdudfwhulvwlfvdqg,qsxw&rqglwlrqv   7deoh,qsxw6zlwfklqj&rqglwlrqv  7deoh&rqwurodqg$gguhvv3lqv  7deoh&orfn'dwd6wurehdqg0dvn3lqv  7deoh'liihuhqwldo,qsxw2shudwlqj&rqglwlrqv &.[&.[?'46[dqg'46[?   7deoh'liihuhqwldo,qsxw2shudwlqj&rqglwlrqv t '9$& iru&.[&.[?'46[dqg'46[?    7deoh6lqjoh(qghg,qsxw6ohz5dwh  7deoh'liihuhqwldo,qsxw6ohz5dwh'hilqlwlrq  7deoh2q'lh7huplqdwlrq'&(ohfwulfdo&kdudfwhulvwlfv     7deoh5 tt (iihfwlyh,pshgdqfhv  7deoh2'76hqvlwlylw\'hilqlwlrq  7deoh2'77hpshudwxuh 9rowdjh6hqvlwlylw\  7deoh2'77lplqj'hilqlwlrqv  7deoh5hihuhqfh6hwwlqjviru2'77lplqj0hdvxuhphqwv  7deoh:'ulyhu,pshgdqfh&kdudfwhulvwlfv  7deoh:'ulyhu3xoo8sdqg3xoo'rzq,pshgdqfh&dofxodwlrqv  7deoh: driver i 2+ /i ol &kdudfwhulvwlfv9 dd  9 ddq  9 7deoh: driver i 2+ /i ol &kdudfwhulvwlfv9 dd  9 ddq  9  7deoh: driver i 2+ /i ol &kdudfwhulvwlfv9 dd  9 ddq  9  7deoh:2xwsxw'ulyhu6hqvlwlylw\'hilqlwlrq  7deoh:2xwsxw'ulyhu9rowdjhdqg7hpshudwxuh6hqvlwlylw\  7deoh:'ulyhu,pshgdqfh&kdudfwhulvwlfv  7deoh:2xwsxw'ulyhu6hqvlwlylw\'hilqlwlrq  7deoh:2xwsxw'ulyhu9rowdjhdqg7hpshudwxuh6hqvlwlylw\  7deoh6lqjoh(qghg2xwsxw'ulyhu&kdudfwhulvwlfv  7deoh'liihuhqwldo2xwsxw'ulyhu&kdudfwhulvwlfv  7deoh6lqjoh(qghg2xwsxw6ohz5dwh  7deoh'liihuhqwldo2xwsxw6ohzudwh'hilqlwlrq  7deoh6shhg%lqv  7deoh(ohfwulfdo&kdudfwhulvwlfvdqg$&2shudwlqj&rqglwlr qv 7deoh&rppdqgdqg$gguhvv6hwxsdqg+rog9doxhv5hihuhqfhg dw9qv$&'&%dvhg   
logic devices incorporated www.logicdevices.com 159 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product 7deoh'hudwlqj9doxhviru t is/ t ,+$&'&%dvhg  7deoh'hudwlqj9doxhviru t is/ t ,+$&'&%dvhg  7deoh0lqlpxp5htxluhg7lph t 9$&deryh9 ,+ $& irud9dolg7udqvlwlrq  7deoh'dwd6hwxsdqg+rog9doxhvdw9qv '46['46[?dw 9qv $&'&edvhg 7deoh'hudwlqj9doxhiru t ds/ t '+$&'&%dvhg  7deoh'hudwlqj9doxhiru t ds/ t '+$&'&%dvhg  7deoh5htxluhg7lph t 9$&$eryh9 ,+ $&  %horz9 ,/>$&@ )rud9dolg7udqvlwlrq  7deoh7uxwk7deoh&rppdqg  7deoh7uxwk7deoh&.(  7deoh5hdg&rppdqg6xppdu\  7deoh:ulwh&rppdqg6xppdu\  7deoh%xuvw2ughu  7deoh%xuvw2ughu  7deoh%xuvw2ughu  7deoh6(/)5()5(6+7hpshudwxuhdqg$8726(/)5()5(6+'hvfulswlrq  7deoh6(/)5()5(6+0rgh6xppdu\  7deoh&200$1'wr32:(5'2:1(qwu\3dudphwhuv  7deoh32:(5'2:10rghv  7deoh32:(5'2:10rghv  7deoh2'73dudphwhu  7deoh'\qdplf2'76shflilf3dudphwhuv  7deoh02'(5(*,67(56iru5 tt_nom 144 7deoh02'(5(*,67(56iru5 77:5 144 7deoh7,0,1*',$*5$06iru'<1$0,&2'7  7deoh6<1&+5212862'73dudphwhuv  7deoh$6<1&+5212862'7wlplqj3dudphwhuviru$oo6shhg%lq v 7deoh2'73dudphwhuviru32:(5'2:1 '//2ii (qwu\dqg([ lw7udqvlwlrq3hulrg   
/2*,&'hylfhv,qfrusrudwhguhvhuyhvwkhuljkwwrpdnhfruuhfwlrqvprglilfdwlrqvhqkdqfhphqwvlpsuryhphqwvdqgrwkhufkdqjh vwrlwv surgxfwvdqgvhuylfhvdwdq\wlphdqgwrglvfrqwlqxhdq\surgxf wruvhuylfhzlwkrxwqrwlfh&xvwrphuvvkrxogrewdlqwkhodwhvwuhohydqwlqirupd - wlrqehiruhsodflqjrughuvdqgvkrxogyhuli\wkdwvxfklqirupdw lrqlvfxuuhqwdqgfrpsohwh/2*,&'hylfhvgrhvqrwdvvxphdq\oldelolw\dulvlqj rxwriwkhdssolfdwlrqruxvhridq\surgxfwruflufxlwghvfulehgkhuhlq,qqrhyhqwvkdoodq\oldelolw\h[fhhgwkhsurgxfws xufkdvhsulfh/2*,& 'hylfhveholhyhvwkhlqirupdwlrqfrqwdlqhgkhuhlqlvdffxudwh krzhyhulwlvqrwoldeohirulqdgyhuwhqwhuuruv,qirupdwlrqvxemhfwwrfkdqjhzlwkrxw qrwlfh/2*,&'hylfhvdvvxphvqroldelolw\iruxvhrilwvsurgxfwvlqplvvlrqfulwlfdoruolihvxssruwdssolfdwlrqv3urgxfwvri/2*,&'hylfhvduhqrw zduudqwhgqrulqwhqghgwrehxvhgiruphglfdoolihvxssruwol ihvdylqjfulwlfdofrqwuroruvdihw\dssolfdwlrqvxqohvvsxuvxdqwwrdqh[suhvvzulwwhq djuhhphqwzlwk/2*,&'hylfhv)xuwkhupruh/2*,&'hylfhvgrhvqrwdxwkrul]hlwvsurgxfwviruxvhdvfulwlfdofrpsrqhqwvlqolihvxssruwv\vwhpv zkhuhdpdoixqfwlrqruidloxuhpd\uhdvrqdeo\ehh[shfwhgwruh vxowlqvljqlilfdqwlqmxu\wrwkhxvhu logic devices incorporated www.logicdevices.com 160 18-20 gb, ddr3, 256 m x 72/80 integrated module L9D3256M72SBG2 preliminary information l9d3256m80sbg2 july 24, 2013 lds-l9d3256mxxsbg2 rev b high performance, integrated memory module product r evision h istory revision engineer issue date description of change $ b   ,1,7,$7( 8sgdwhgwdeohvwrlqfoxghgdwdiru9'' 9 .+/ %loo9ro]


▲Up To Search▲   

 
Price & Availability of L9D3256M72SBG2

All Rights Reserved © IC-ON-LINE 2003 - 2022  

[Add Bookmark] [Contact Us] [Link exchange] [Privacy policy]
Mirror Sites :  [www.datasheet.hk]   [www.maxim4u.com]  [www.ic-on-line.cn] [www.ic-on-line.com] [www.ic-on-line.net] [www.alldatasheet.com.cn] [www.gdcy.com]  [www.gdcy.net]


 . . . . .
  We use cookies to deliver the best possible web experience and assist with our advertising efforts. By continuing to use this site, you consent to the use of cookies. For more information on cookies, please take a look at our Privacy Policy. X